KEGG   Streptacidiphilus sp. DSM 106435: C7M71_020310Help
Entry
C7M71_020310      CDS       T05561                                 

Gene name
sodN
Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
stri  Streptacidiphilus sp. DSM 106435
Brite
KEGG Orthology (KO) [BR:stri00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7M71_020310 (sodN)
Enzymes [BR:stri01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C7M71_020310 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AXI79403
UniProt: A0A345T098
LinkDB All DBs
Position
complement(4543398..4543793)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPRVTVHAHCDLPCGVYDPAQARIEAESVKAVQDKYQANEDASFRTRAIIIKEQ
RAELAKHHLSVLWSDYFKAPHFEKYPQLHQLFNDALKAASAAKASNDPATGQALLDLIAE
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctctcgtctgtttgcaccgcgggtcaccgtccacgctcactgcgatctgccgtgc
ggcgtgtacgacccggcccaggcccggatcgaggccgagtccgtgaaggccgtccaggac
aagtaccaggccaatgaggacgccagcttccgcacccgggccatcatcatcaaggagcag
cgggccgagctcgccaagcaccacctctcggtgctctggagcgactacttcaaggccccg
cacttcgagaagtacccccagctccaccagctcttcaacgacgccctcaaggccgccagc
gccgccaaggcgtccaacgacccggccaccggccaggccctgctggacctgatcgccgag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system