KEGG   Streptacidiphilus sp. DSM 106435: C7M71_022090Help
Entry
C7M71_022090      CDS       T05561                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
stri  Streptacidiphilus sp. DSM 106435
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AXI79691
UniProt: A0A345T136
LinkDB All DBs
Position
4960367..4961440
Genome map
AA seq 357 aa AA seqDB search
MDLPVMPPVKPMLARSAAQIPPGMQYEGKWDGFRAIVFRDGGEVEIGSRTGKPLTRYFPE
VVQALAAALPPRCVVDGEIVIVRGSRLDFDALLERIHPADSRVRLLAERTPASFVAFDLL
ALDDVSLMDTPLVERRRALVEALGEAPTGPVHLAPATTDLETARRWFDQYEGAGLDGVVA
KPLDIGYRPDERVMVKVKHERTADCVLAGFRFHKSGPVVGSLLLGLYDGQGRLQHVGVCA
SFPMRRRQALVEELEPLRMESPAGHPWASWADEEAAAADRMPGAPSRWTGKKDLSWVPLR
PERVCEVAYDHMQGGRFRHTAQFRRWRPDREPRGCTYAQLEEPVRFDLADVLSGPNG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaccttccggtgatgccgcctgtgaagccgatgcttgccagatcggccgcgcagatc
ccgccggggatgcagtacgagggcaagtgggacggcttccgggcgatcgtcttccgggac
ggcggtgaggtcgagatcggcagccgtacgggcaagccgctgacccgctacttccccgag
gtggtgcaggccctggcggcggcgctgccgccgcgctgcgtggttgacggggagatcgtg
atcgtccggggcagccgtctggacttcgacgcgctgctggagcggatccatccggccgac
tcgcgggtgcggctgctggcggagcggaccccggcgagctttgttgccttcgatctgctg
gcgctggacgacgtctcgctgatggacacgccgctggtggagcgccgccgggccctggtg
gaggcgctgggggaggcgccgaccgggccggtccacctggccccggccaccaccgatctg
gagaccgcccggcgctggttcgaccagtacgagggggccggattggacggcgtcgtggcc
aagccgctagacatcggctaccggccggacgagcgggtgatggtgaaggtgaagcacgag
cgtacggccgactgcgtgctggccgggttccgcttccacaagagcggcccggtggtgggt
tcgctgctgctcggcctgtacgacgggcaggggcggttgcagcatgtcggcgtctgcgcg
tcctttccgatgcgccgccggcaggcgctggtggaggagttggaaccgctgcggatggag
tcgccggccggtcatccatgggcgtcgtgggcggacgaggaggcggcggcggccgaccgg
atgcccggggcgcccagccgctggaccgggaagaaggacctgtcctgggtgccgctccgg
ccggagcgggtctgcgaggtcgcgtacgaccatatgcagggcggccggttccggcacacg
gcgcagttccgccgctggcggccggaccgggagccgcgcggctgcacctatgcgcagttg
gaggagccggtgcggttcgacctggcggatgtgctgtcgggcccgaacgggtga

DBGET integrated database retrieval system