KEGG   Streptacidiphilus sp. DSM 106435: C7M71_023065Help
Entry
C7M71_023065      CDS       T05561                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
stri  Streptacidiphilus sp. DSM 106435
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AXI79852
UniProt: A0A345T1J7
LinkDB All DBs
Position
5198932..5199921
Genome map
AA seq 329 aa AA seqDB search
MKAVVITEPGSVELTTVEDPTPGPREVVVAVAACGLCGTDLHILQGEFAPTLPIVPGHEF
AGEVVAVGSAVTEVAVGARVAVDPSLHCGECHYCRMGRGNLCERWAAIGVTEPGGAAEFA
VAPVANCVVLPDHVATADAALIEPLSCAVRGYDVLRSKLADHVLIYGSGTMGLMMLELAK
RTGAATVDMVDLNPDRLATARLLGCSNATASADEIARPRGWDVVIDATGNAAAIQDGLGR
VGRGGTFLQFGVADYATRAVIEPYRIYNQEITITGSMAVLHSYERAAELFAAGVLDPGVF
ISDRMPLADYAHALERFQAGVGRKIQVVP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcgtcatcaccgagcccggcagtgtcgagctcaccaccgtcgaggacccg
acccccggcccccgcgaggtggtggtcgccgtcgcggcgtgcggcctctgcggcaccgat
ctgcacatcctccagggcgagttcgccccgacgctgccgatcgtgccgggacacgagttc
gccggggaggtggtggccgtcggctccgccgtcaccgaggtggccgtgggcgcccgggtc
gccgtcgacccctcgctgcactgcggggagtgccactactgccggatgggccggggcaac
ctctgcgagcggtgggccgccatcggcgtcaccgagccgggcggcgccgccgagttcgcc
gtcgcgccggtcgccaactgcgtggtgctgcccgaccatgtggcgaccgccgacgccgcc
ctcatcgaaccgctctcctgcgcggtacgcggctatgacgtgctgcgcagcaagctggcc
gaccatgtgctgatctacggctccggcaccatggggctgatgatgctggaactcgccaag
cgcaccggcgccgcgaccgtcgacatggtcgacctcaacccggaccggctcgccaccgcc
cggctgctgggatgcagcaacgccaccgcctcggcggacgagatcgcgcggccgcgcggc
tgggatgtggtgatcgacgccaccggcaacgccgccgcgatccaggacggcctgggcagg
gtcggccgcggtggtaccttcctccagttcggcgtcgcggactacgccacccgggccgtc
atcgagccctaccggatctacaaccaggagatcaccatcaccggctccatggccgtgctg
cacagctacgagcgggccgccgaactcttcgcggcgggcgtcctggacccgggtgtcttc
atcagcgaccggatgccgctcgccgactacgcccacgccctggagcgcttccaggccgga
gtgggacgcaagatccaggtggtgccgtga

DBGET integrated database retrieval system