KEGG   Streptacidiphilus sp. DSM 106435: C7M71_024275Help
Entry
C7M71_024275      CDS       T05561                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
stri  Streptacidiphilus sp. DSM 106435
Pathway
stri00564  Glycerophospholipid metabolism
stri01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C7M71_024275
Enzymes [BR:stri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C7M71_024275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox NAD_binding_8 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AXI80055
UniProt: A0A345T250
LinkDB All DBs
Position
5500320..5502032
Genome map
AA seq 570 aa AA seqDB search
MVKPVALSPQSRAEALYRLGDQELDILVVGGGVVGAGAALDAATRGLSVGLVEARDWASG
TSSRSSKLIHGGLRYLEMLDFRLVAEALRERGLLLQRIAPHLVRPVPFLYPLQHRVWERP
YVGSGVLLYDTMGITSGNARGLPRHRHLTRRGALREAPALRTDALVGAVQYWDAQVDDAR
HTMTTARTAAAYGALVANRTRVTRFLRQGERVVGAAVTDLETGTETEVRARQVINATGVW
TDDTQAMAGTRGQFHVRASKGVHLLVPRDRINSRTGLILRTEKSVLFVIPWGRHWIVGTT
DTDWDLDKFHPAASARDIEYLLDHVNQVLVTPLLPEDVEGVYAGLRPLLSGEAADTSKLS
REHLVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVRALDEKVPGCTTDTVPLLGADGFQA
IWNARHTLARRSGLHVARVEHLLRRYGSLVNEVLDLVAADPSLGEPLPSSDDYLRAEAVY
AVTHEGARHLDDVLARRTRISIESWDRGVDAARTVAGLMAEPLGWGEDQVEREIDHYLKR
VEAERQAQEQPDDHTADAVRLGAPEIVPPA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagccggtggcactctcgccccagtcccgcgccgaagcgctctaccgcctcggc
gatcaggaactcgacatcctcgtggtgggcggcggcgtggtcggcgccggagccgccctc
gacgccgccacccggggcctctccgtcggcctggtcgaggcccgcgactgggcctccggc
acctccagccgctccagcaagctgatccacggcgggctgcgctacctggagatgctggac
ttccggctggtcgccgaggccctgcgggagcgcggcctgctgctccagcggatcgccccc
cacctggtccgccccgtgccgttcctctacccgctccagcaccgcgtctgggaacgcccc
tacgtcggctccggcgtgctgctgtacgacaccatgggcatcacctccggcaatgcccgg
ggcctgccccgccaccgccacctcacccgccggggcgccctgcgggaggcccccgcgctc
cgtaccgacgcgctggtcggcgccgtccagtactgggacgcccaggtcgacgacgcccgg
cacaccatgaccaccgcccgcaccgccgccgcgtacggcgcgctggtcgccaaccgcacc
cgggtcacccgcttcctgcgccagggcgaacgcgtcgtcggcgccgccgtcaccgacctg
gagaccgggaccgagacggaggtgcgcgcccggcaggtgatcaacgccaccggcgtctgg
accgacgacacccaggcgatggccggcacccggggccagttccatgtacgggcctccaag
ggcgtccacctgctggtgccccgcgaccgcatcaactcccgcaccgggctgatcctgcgg
accgagaaatccgtgctcttcgtcatcccctggggccgccactggatcgtcggcaccacc
gacaccgactgggacctcgacaagttccaccccgccgccagcgcccgggacatcgagtac
ctgctggaccacgtcaaccaggtcctggtcaccccgctcctcccggaggacgtcgaaggc
gtctacgccggcctgcgcccgctgctctccggcgaggccgccgacaccagcaagctctcc
cgggaacacctggtcgcccaccccgtgcccggcctggtcgtggtcgccggcggcaaatac
accacctaccgggtgatggccaaggacgctgtggacgaggccgtacgcgccctcgacgag
aaggtgcccgggtgcaccaccgacaccgtgccgctgctcggcgccgacggcttccaggcc
atctggaacgcccgccacaccctcgcccgccgctccggtctgcatgtcgcccgggtggag
cacctgctgcgccgctacggctccctggtcaacgaggtgctcgacctggtcgccgccgac
ccctccctcggcgaaccgctgcccagctccgacgactacctgcgcgccgaggccgtctac
gcggtcacccatgagggcgcccggcacctggacgacgtgctcgcccgccgcacccggatc
tccatcgagtcctgggaccggggcgtggacgccgcccgcaccgtcgccgggctgatggcc
gaacccctcggctggggcgaggaccaggtggagcgggagatcgaccactacctcaagcgg
gtggaggccgaacggcaggcccaggagcagcccgacgaccacacggcggacgccgtacgc
ctcggcgcacccgagatcgtcccaccggcctga

DBGET integrated database retrieval system