KEGG   Streptomyces sp. Mg1: M444_04815Help
Entry
M444_04815        CDS       T03958                                 

Definition
(GenBank) polyketide synthase
Organism
strm  Streptomyces sp. Mg1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt PS-DH Acyl_transf_1 KR Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Thiolase_N ADH_zinc_N_2 ADH_zinc_N Epimerase Docking Polysacc_synt_2 NmrA ACP_syn_III ADH_N
Motif
Other DBs
NCBI-ProteinID: AKL64829
UniProt: A0A0G3UEY0
LinkDB All DBs
Position
1:complement(1094175..1116644)
Genome map
AA seq 7489 aa AA seqDB search
MADQVADQDKIIGYLKRVTADLHQTRQRLREVEAQEPEPIAIVGMACRFPGGIQSPEDLW
DLVAGGRDAITDFPTDRGWDIESLYDADPEQRGTSYTREGGFLDGVGEFDAAFFGISPRE
TLGMDPQQRLLLETSWETFERAGIDPATLRGSKAGVFIGTNGQDYPDLLRDGVPEGVEQY
LLTGNAASVVSGRLSYTFGLEGPSVTIDTACSSSLVALHLAVQALRGGECSLALAGGVTV
MSSPRAFVQFSRQRGLAPDGRCKPFADGADGTGWGEGVGMLLVEKLSDARRLGHPVLAVV
RGSAINQDGASNGLTAPNGPSQQRVIRQALTNAGLTPAQVDVIEAHGTGTTLGDPIEAQA
ILATYGQNRPEGRPLWLGSIKSNIGHTQAAAGVAGIIKMVEAMRHGVVPESLHIDQPSGA
VDWATGAVELLTRAVPWPETGQPRRAGISSFGVSGTNAHTVIEQAPPAEVPGADAKAEDT
GATDSGDQAAGAEGATGPVPLLVSGQGDDALRAQAGRLAAHLRAHPELAADPAALTDLGF
SLATSRSALDRRAVLFAADRELLLADLDALAAAEQPATAVLGAVGDGNTAFLFTGQGSQR
PGMGRELYATHPGFARALDAVRDELDRHLERPLYEVLFAAEGTPEAALLDATAYTQAALF
AIEVALYRQLEQWGVTADFLIGHSIGELAAAHVSGVLTLPDAAALVAARGRLMQALPAGG
AMIAVEATEDEITPLLTDRVSVAAVNGPRSVVVSGDEDAAGELAETLRARGRRVKRLTVS
HAFHSPLMDPMLDAFREAAEAVSYAPPVIPIVSNLTGASVTAEEICTADYWVRHVREAVR
FHDGVRGLAALGVTTFVEVGPGGVLTALAQDCLTGENDRDDAVFIPALRADRPEPAAFAA
AVAQAHVHGVTADWSAVFADRGATRVDLPTYAFQRGRYWPEAPTAWTGDVTAAGIGSADH
PLLGAAIALADGDGYLFTGRLSLATHPWLADHTVMDTVLLPGTAFVELALQAGEHTGCEL
LEELTLQAPLALPPHGGVQIQLAVGAPDGDGRRSLTLHSRPEDAADDTWGEGAWTRHATG
SLAPAARDAASTPAGADLTTWPPRDATAVPVDGLYEHLTASGFAYGPVFQGLTGAWQRAD
EVFAEVRLPEQAHAEAALFGLHPALLDAALHAVGIGSLLEDTEHGRLPFSWSGVTLRAVG
ARALRVRLAPAGQDTVSVDLADETGAPVASVAALLLRPVSPDQVHAARTAFHDSLFRVEW
NPLALPAATTVAPGQWALLAGPDAEAGDAGALAGTAARFAAVLPAAAVHNGLAALSAAIE
AGGPVPQAVVVPVAAPAAPAPTPADATLPAAVGDALHHALELAQAWLADDRYAGSRLVLV
TRGAVATTAGSDVPDLAHAPLWGLLRSAQSEHPDRFVLLDLDDREESLRALPAALATAEP
QLALREGRAVVPRLGRVPALPAAEGQEARPLDADGTALVTGATGTLGGLVARHLVTGHGV
RRLLLTSRRGEAAAGAPELLAELRALGAEVTLAACDAADREALAAVLASVPAAHPLTAVF
HTAGVLDDGILEALTPERLDHVLPAKVDAAVHLHELTRDLDLAAFVLFSAAAGTLGAAGQ
ANYAAANTFLDALAQRRHTEGLPATALAWGLWAERSGMTGDLADTDLERISRAGVAALSS
AEGLALMDTACATGEPTAVPMHLDLAALRHADADMVPALLRGLVRPAARRAAAQSAAPAD
GLTERLLPLTAAERDRLLLATVRVQVAAVLGFPGPDAVDPGRAFKELGFDSLTAVELRNR
LGSATGVRLPATLVFDYPTPNALAAFLRTELLGDQAAPAPAATAAAIRAVADEPIAIVAM
SCRYPGGVSTPEELWQLVAGSADAISPFPTDRGWNLDALYDSDPGRAGTSYTREGGFLHD
AADFDPDVFGINPREALAMDPHQRLLLETSWEAFERAGIDPATVRGSRTGVFAGVMYHDY
LTRLPAVPEGLEGYLGTGTAGSVASGRISYTFGLEGPAVTIDTACSSSLVALHLAAQALR
SGECDMALAGGVTVMSTPDTFIDFSRQRGLSTDGRCKSFSADADGTGWAEGAGMILVERL
SDARRNGHPVLAVVRGTAVNQDGASNGLTAPNGPSQQRVIREALAHAGLTTADVDAVEAH
GTGTTLGDPIEAQALLATYGQDRPADRPLRLGSIKSNIGHTQAAAGAAGIIKMVLAMRHG
VLPASLHIGEPSPHIDWTAGAVELLTESATWPETDRPRRAGISSFGVSGTNAHVIIEQPP
VEQPSDEKDGGEPGVPAVAGGTVPAGTPLPFVLSGRTPDALRAQAARLADHLAHHPDAAP
ADVAFSLATTRTALDRRAAVVAPDRDGLLAALAALAEGRDGARIVRHDTADGRTAVLFTG
QGSQRPGMGRELHATYPVFAAALDAVCAELDRHLEQPLKEILFDEDAGDLLNRTGYTQPA
LFALETALYRLVESWGLRPDFVAGHSIGEITAAHVAGVLSLPDAATLVAARGRLMEALPQ
GGAMIALTATEDEVRPLLAGHEDRIGIAAVNSASSVVISGEETLALEIAAEFERRGRRTK
RLTVSHAFHSPLMDGMLDAFRDVAASLTYHAPAIPVVTHLTGAVAGDELRTAEHWVSHVR
EAVRFLDGIRTLDAEHVTTYLELGPQGVLSGLGRDCLTETDGATDPLFVPALRRDRGEAE
ALTAAIAAVHTRAVPLDWPAYFAATGARRVDLPTYAFQRTRFWLEAPAGYIGDVESAGLG
AAHHPLLGAAVPLADGEGFLFTGRLSLDTHPWLADHAVMGTVLLPGTAFVELAVRAGDQA
GCDVLEELTLEAPLVLAPHTAVRLQIVVSAPDQDGRRTLDLYSGDPDAADDEPWTRHAAG
VLATGAPRPAFDLAAWPPPGAEAVSVDGLYEHLGQGGFAYGPVFQGLRAAWTLGDDVYAE
VALPDDRHTEATRFGLHPALLDAALHATFVSQDGDRQAGLPFSWRGVSLHAVGASALRVR
LTADGDDSLSLQLADTTGAPVATVDHLIVRPVSADRLAGASRTAYHESLFRVEWATLPLP
PGAPGEDTTGTWAVIGEPADVTAELPGPVHPGLGALGAALDAGAPAPAHVLAPCLAAPAE
ALTADAVRAATHRALALVQGWLADDRFAASRLVFVTRGAVATQSDWDLADPAHAAVWGLV
RSAQSENPDRFVLADLDADAAAGTLAAALATGEPQFALRRGTVHAPRLARVPATTPLTPP
PGESAWRMDIEDKGTLDHLTLVPSPESAAPLEPGQVRVAVRAAGLNFRDVLNALGMYPGD
PGLMGSEGAGTVVETGPGVSDLAPGDRVMGMLPGAFGPLAVVDRRMIAPMPEGWTFAEAA
AVPIVFMTAYYALHDLAGLREGESLLVHAAAGGVGMAAVQLARHWGADVYATASPAKWDT
LRGLGLTDDKIASSRTLDFENTFRTATDGHGVDVVLDSLAREFVDASLRLLPRGGRFVEM
GKTDVRDPRDVAATHPGVSYQAFDLTEAGLDRIQEMLTELLGLFEAGALNPIPVSAWDLR
QAPEAFRYLSQARHTGKIVLTVPADWNPDGTVLITGGTGTLGAFVARHAVTVRGARRLIL
TSRRGEAAAGAAELAAQLRALGADVTVAACDAADREALAALLASIPAAHPLTAVVHTAGV
LDDGIAEALTPERLDRVLRPKADAALHLHELTRHLDLADFVLFSSAAGTFGGAGQANYAA
ANVFLDALARHRQAHGLPGTSLGWGLWAEASGMTGELDSADKDRMTRSGVLGLSSEEGLA
LLDTAHHTGDAHLVPMQLDLAPLRQADAAMVPALLRGLVRAPARRTAQAATAGTGTPLVE
QLVRLPENERDTLLLDLVRDQVAAVLGHATSDAVEPGRAFKDLGFDSLTAVEFRNRLGAT
AGVRLPATLVFDYPTPTVLAGYLKDELLGSEAAVAAAALPRHPAGAVAETDDPIAIVAMS
CRFPGDVRSPEDLWELLAEGRDGIADLPADRGWDTEALYDPDPDSPGTSYAREGGFFYDA
HHFDPAFFGINPREALAMDPQQRLLLETSWEAFERAGIDPTGLRGGQVGVFVGQMHNDYV
SRLNTVPEGVEGYLGTGGSSSIASGRVSYTFGFEGPAVTVDTACSSSLVALHLAAQALRS
GECSLALAGGVTIITTPDVFTEFSRQRGLAADGRCKPFAAAADGTAWGEGVGMLLVERLS
DARRNGHQVLAVVRGTAVNQDGASNGLTAPNGPAQQRVIRQALANARLTSADVDAVEAHG
TGTTLGDPIEAQALLATYGQGRPEDTPLWLGSVKSNFGHTQAAAGVAGIIKMVQAMRHGV
LPKTLHVDEPSPHVDWSAGAVSLLTEQRAWPETGRPRRAGVSSFGMSGTNAHAIIELPET
PAAAVSPAVPAPATALPWHLSARTPEALRAQGEQLLSHLEAHPDTLPADIGHSLVTARAV
FEHRATVVATDPDAFRTGLAALAEGRSAAGLVQGSSAAAGKLAFLFTGQGSQRLGMGREL
YETYPAFAAALDAVCDALELPLKDVLFGTDADVLDRTEYTQLALFAVEVALFRLVESWGV
KPDFLSGHSIGEIAAAHVAGVLSLADACTLVAARGRLMQALPSGGVMIAVEAAEEEVLPL
LTDRVSIAAVNGPRSVVIAGDEDAALALVAAFADRKTKRLTVSHAFHSPHMDGMLDDFRE
VVAGLSFAAPRIPVVSNLTGALVTDEMGSAEFWVRHVREAVRFLDGVRALEAAGVTTYVE
LGPDGVLSAMAQACLTDDTGAAAFAPALRSGRDEPTTLLSALSTAYVRGTAVDWSAYYAP
LGAGRVDLPTYAFQRSVYWLDAGRADGDVAAAGLGAADHPLLGAEVQLPDSDGHLFTGRL
SLTTHPWLGDHRVMGAALLPGTAFVELALQAGEHVGCDLVDELTLEAPLVLPEHGGVQLR
LSVAAADPAGRRRSLTLHSRPEGADADEPWTRHAVGVLATGAAPTPQGLTEWPPAGAEPV
PVDGLYEGLAEAGFGYGPVFQGLRAAWQHGDTSYAEVALPEGAEGEAARFGLHPALLDAA
LHALGLRAADTGADGRLPFSWSGVSLHAVGACELRVRLTTGLGGEVALTIADATGAPVAS
VAGLALRSVSRDQLTAAPDLTRDALFRVEWAQTTAGDGSFDDWLMLGEEGDGALPAALVV
PCVEPAAGDVAGAVHAETARVLGLVQDWLAEERSADARLVFLTRGAVAAVPGEGIADLAH
APVWGLVRSAQSENPGRFVLVDIDAEGDLAAGLSAALASGESEVAVRGGSVLVPRLARTA
VAADAGAEWDAGGTVLVTGASGSLGGLFARHLVAEHGVRRLLLVSRRGEGAALSAELAGL
GAEVSWAACDVADRDALAAVLKAVPAEHPLTAVVHTAGVLDDGVVGSLTTERLSAVLRPK
VDAAWNLHELTQDLGLSAFVLFSSAAGVFGGAGQANYAAGNVFLDALAAHRRAQGLAATS
LAWGLWTGVGGMGGDLADGDRERINRGGIGALSPETGLALFDAARRTDDALLVPLPLDLA
ALRAQARAGTVPDLLRGLVRVPARRAAGQGATADGSALRTRLAALPAEEREAALLEMVRA
EVTAVLGHASTDEVPADRAFKELGFDSLTSVELRNRLGAATGERLPATLVFDYPTPSALA
AYLRTEVLGLSLDEETAGAATAGPASAGAALQDDPIAIVGMSCRYPGGVETPEDLWRLVV
GGVDAISEFPQGRGWDLESLYDPDPDGKGTSYTRSGGFLHDAGRFDPAFFGISPREAVAM
DPQQRLLLETSWEAFERAGIDPASMRGSRTGVFAGVMYHDYATRITSVPDGVEGYLGTGN
SGSIASGRVSYAFGLEGPAVTVDTACSSSLVALHWAIQALRGGECTMALAGGVTVMSTPG
TFTEFSRQRGLAADGRIKSFAAAADGTSWAEGAGMLLVERLSDARRNGHPVLAVVRGSAI
NQDGASNGLTAPNGPSQQRVIRQALASGGLTSEQIDVVEAHGTGTTLGDPIEAQALLATY
GRERAADEPLWLGSIKSNMGHTQAAAGVAGVIKMIMAMRHGVLPRTLHVDEPTPHVDWED
GAVTLLTENTPWPQTGRPRRAGVSSFGISGTNAHTIIEQAPDAVAVSAAAESGAAAPVLP
YVLSARSADALRGQAARLRVHLEDSAELSVTDVAYSLATRRAAFDHRAVVVAGDREELLR
GLEALGNNDLADAAVTRGTVGAAGAGKLAFLFTGQGSQRLGMGRELYEAFPAFAAALDAV
CERMDLELPLTDVLFGTDADVLDRTEYTQPALFAVEVALYRLVESWGVKPDFLSGHSIGE
IAAAHVAGVLSLEDACELVRARGRLMQALPSGGVMIAVQASEEEVLPLLTDRVSIAAVNG
PRSVVVAGDEDAALAIAGAFPDRKSKRLTVSHAFHSPHMDGMLADFRKVAEALSYGAPRI
PVVSNLTGALVTDEMGSADFWVRHVRDAVRFLDGIRTLEAAGVTTYLELGPDGVLSAMAQ
DCLTEDGARFAPALRTGRPEPETLNNALAHAHAHGAAVDWEAYFAPTGARQAELPTYAFQ
RDWYWLDSAPTAHNTPGDAAGFGLGATDHPLLGAAVELPDSDGFLFTGRLSLATHAWLAD
HAVLGSVLLPGTAFVELAVRAGDQVGCDVLEELTLEAPLVLPERGGVQLRLSVAEADESG
RRALSLYSRDEDTPADEPWTRHAAGVLATGDAPAPAADLTVWPPAGAEPVDIDGLYEGLA
AAGFDYGPAFQGLRSAWLHGDAVYAEVSLDEETAEAADWFGLHPALLDATLHAAGLGALV
EKTGQGRLPFAWSGVRLHAAGAGAVRVRLAPAGRDAVALELADPAGAPVASVESLVLRAV
SPEQIGAARGGRPESLFEVEWTAVPLTPVSASEQSPWALLGDGHAGLDAVGVRYTAHDGG
LATLADPALVCVPLSPVSGTEDVTGAVHAETGRVLALLKEWLAEERFADSRLVFLTRGAV
EAVPGEGVPDLVHASVWGLLRSAQSENPGRIVLADTDGTDASFRALPAVVASGESEVAVR
GGSVLVPRLARAAVAADAGAEWDAEGTVLITGASGSLGGLFARHLVTEHGVRRLLLVSRR
GEGAALSAELAGLGAEVSWAACDVADRDALAAVLKAVPAEHPLTAVVHTAGVLDDGVVGS
LTAERLSAVLRPKVDAAWNLHELTQDLDLSAFVLFSSAAGVFGGAGQANYAAGNVFLDAL
AAHRRAQGLAATSLAWGLWAEAGGMGGGLDAEDVSRLGRGGVDAITAAEGVALFDAATSA
EQALLVPVKLDLAALRAQAGSGMLPPLLSGLVRTPARRAAGTTAAGTDGGAELRERLTGL
SPAARDEALLELVCGYVAGVLGFAGPEAVDPARSFNEVGFDSLTAVELRNRLGAATGVRL
PATLVFDYPTPTALVEYLKDELWQDGAAAVPPLLAELDRLEKSLVTSTPDGAGRDRITER
LQALLAAWSEAGELAAAPADSDGPDVAEALESATDDDLFDFIGKEFGIS
NT seq 22470 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaggtagcagatcaggacaagatcatcggctacttgaagcgggtgacggcc
gatctgcaccagacgcggcagcgcctgcgcgaggtcgaggcccaggaaccggagccgatc
gccatcgtcggcatggcctgcaggttccccggcggcatccagtcgccggaggacctgtgg
gacctcgtcgcgggcggccgggacgccatcaccgacttccccaccgaccgaggctgggac
atcgagtccctgtacgacgccgaccccgagcagcgcggcacctcgtacacccgcgagggc
ggattcctcgacggggtcggcgagttcgacgccgcgttcttcgggatcagcccccgcgag
accctcggcatggaccctcagcagcgcctgctgctcgaaacgtcctgggagaccttcgag
cgcgccggcatcgacccggcgacgctgcgcggcagcaaggccggcgtgttcatcggcacc
aacggccaggactaccccgacctgctccgcgacggcgtccccgagggcgtcgagcagtac
ctcctcaccggaaacgccgccagcgtcgtctccggccgcctctcctacaccttcggcctc
gaaggcccctccgtcaccatcgacaccgcctgctcctcctcgctcgtcgccctccacctc
gcggtgcaggcgctgcgcggcggcgaatgctccctggcgctggcgggcggcgtcaccgtc
atgtccagcccgcgcgccttcgtccagttcagccgccagcgcggactcgcccccgacggc
cgctgcaagcccttcgccgacggcgccgacggcaccggctggggcgagggcgtcggcatg
ctcctcgtcgagaagctctccgacgcccgccgcctcgggcaccccgtgctcgccgtggtc
cgcggcagcgccatcaaccaggacggcgcctccaacggcctcaccgcccccaacggcccc
tcccagcagcgcgtcatccgccaggcgctgaccaacgccggactcaccccggcgcaggtc
gacgtcatcgaggcgcacggcaccggcaccaccctcggcgaccccatcgaggcccaggcc
atcctggccacctacggccagaaccggcccgagggccggccgctgtggctgggctccatc
aagtccaacatcggtcacacccaggccgccgccggtgtcgcgggcatcatcaagatggtc
gaggcgatgaggcacggcgtcgtgcccgagtccctccacatcgaccagccgtccggcgcc
gtcgactgggccaccggcgccgtcgaactgctcacgcgggccgtgccgtggcccgagacc
gggcagccgcgccgcgccggcatctcctccttcggcgtcagtggcaccaacgcccacacc
gtcatcgaacaggccccgcccgccgaggtccccggcgcggacgcgaaagccgaggacacg
ggcgccacggacagcggcgaccaggcagccggcgcggaaggcgccaccggcccggtaccg
ctgctggtctccggccagggcgacgacgccctgcgcgcccaggccggccgcctcgccgcc
cacctgcgcgcccaccccgaactcgccgcggaccccgcggccctgaccgacctcgggttc
tccctcgccaccagccgctccgcgctggaccgccgggccgtcctcttcgccgccgaccgc
gagctgctcctcgccgacctcgacgcgctcgccgccgcggagcagcccgcgaccgccgtc
ctcggcgccgtcggcgacggcaacaccgccttcctcttcaccggccagggcagccagcgc
cccggcatgggccgggagctgtacgccacccaccccgggttcgcgcgcgccctcgacgcg
gtccgcgacgaactcgaccggcacctcgaacgccccctgtacgaggtgctgttcgcggcc
gagggcacccccgaggcggcgctcctcgacgcgaccgcctacacccaggccgccctgttc
gccatcgaggtcgccctctaccggcagctcgaacagtggggcgtcaccgccgacttcctc
atcggacactccatcggcgaactcgccgccgcccacgtctccggggtcctcaccctcccc
gacgcggccgccctcgtggccgcccgcggccgcctcatgcaggccctgcccgccggcggc
gcgatgatcgccgtcgaggccaccgaggacgagatcaccccgctgctcaccgaccgggtg
tccgtggctgccgtcaacggcccccgctccgtggtcgtctccggtgacgaggacgctgcc
ggggaactcgccgagacgctgcgcgcccgcggccgccgcgtcaagcggctcaccgtcagc
cacgccttccactcgccgctcatggaccccatgctcgacgcgttccgcgaggccgccgaa
gccgtctcctacgcgccgcccgtcatcccgatcgtctccaacctcaccggcgcctccgtc
accgccgaggagatctgcaccgccgactactgggtccgccacgtccgcgaggccgtccgc
ttccacgacggggtgcggggcctggccgcgctcggcgtcaccaccttcgtcgaggtcggc
cccggcggggtcctcaccgccctcgcgcaggactgcctcaccggcgagaacgaccgggac
gacgccgtcttcatccccgccctgcgcgccgaccgccccgaaccggccgcgttcgccgcc
gccgtcgcccaggcgcacgtccacggcgtcaccgccgactggtccgccgtcttcgcggac
cgcggcgccacccgcgtcgacctgcccacgtacgccttccagcgcggccggtactggccc
gaagcgcccaccgcctggaccggcgacgtcaccgccgccgggatcggctccgccgaccac
ccgctgctcggcgcggccatcgccctggccgacggcgacggctacctgttcaccggccgg
ctctcgctggccacccacccctggctcgccgaccacacggtcatggacaccgtgctgctg
cccggcaccgccttcgtggaactcgccctccaggccggcgaacacaccggctgcgaactc
ctcgaagagctcaccctccaggcccccctggccctgcccccgcacggcggcgtccagatc
cagctcgccgtcggcgcccccgacggcgacggacggcgctccctgaccctgcactcccgg
cccgaggacgccgccgacgacacctggggcgaaggcgcctggacccggcacgccaccggc
tccctcgcccccgccgcacgcgacgccgcgagcaccccggcgggcgccgacctcaccacc
tggccgccgcgggacgccaccgccgtccccgtcgacggcctctacgagcacctcaccgcc
tccggcttcgcctacgggcccgtcttccagggcctgaccggcgcctggcagcgcgccgac
gaggtcttcgccgaagtccgcctgcccgagcaggcacacgccgaagccgccctgttcggc
ctgcaccccgccctgctggacgccgccctgcacgccgtcggcatcggctccctgctggag
gacaccgagcacggcaggctgccgttctcctggagcggcgtcaccctccgcgccgtcggc
gcccgcgccctgcgcgtccgcctcgcccccgccggccaggacaccgtctccgtcgacctc
gccgacgagaccggcgcgcccgtcgcctccgtggccgcgctgctgttgcggcccgtctcc
ccggaccaggtccacgccgcgcgcaccgccttccacgactccctgttccgcgtcgagtgg
aacccgctggccctgccggccgccaccaccgtcgcccccggccagtgggcgctgctcgcg
ggccccgacgccgaggccggtgatgccggtgctctcgccggcaccgcggcccggttcgcc
gccgtgctgcccgccgccgccgtccacaacggcctcgccgcgctctccgccgcgatcgag
gcgggcggccccgtaccgcaggccgtcgtcgtccccgtcgccgcccccgccgcccccgcg
ccgacccccgccgacgcgaccctgcccgccgccgtcggcgacgcgctgcaccacgccctg
gaactggcccaggcctggctcgccgacgaccgctacgccggctcccggctcgtcctcgtc
acccggggcgccgtcgccaccaccgccggctccgacgtgcccgacctggcgcacgccccg
ctgtggggcctgctgcgctccgcccagtccgagcaccccgaccggttcgtcctgctcgac
ctggacgaccgcgaggagtccctgcgtgccctgccggccgcgctggccaccgccgaaccc
cagctcgccctccgcgagggccgcgccgtcgtgccccggctcggccgcgtccccgctctg
cccgcggccgaggggcaggaagcccgcccgctcgacgcggacggcaccgccctcgtcacc
ggcgccaccggcaccctcggcgggctcgtcgcccgccacctcgtcaccggacacggcgtc
cgccgcctgctgctgaccagccgtcgcggcgaagccgccgcaggcgcccccgaactgctg
gcggagctgcgcgccctgggcgccgaggtcaccctcgccgcctgcgacgccgccgaccgc
gaggccctcgccgcggtgctggcctccgtaccggccgcgcacccgctgacggccgtcttc
cacaccgccggagtcctcgacgacggcatcctcgaagcgctcacccccgagcggctcgac
cacgtcctgcccgcgaaggtcgacgcggccgtccacctgcacgagctgacccgcgacctc
gacctcgccgcgttcgtcctcttctccgccgccgccggcaccctcggcgccgccggacag
gccaactacgccgccgccaacaccttcctcgacgccctcgcccagcgccgccacaccgaa
ggcctgcccgccaccgcgctcgcctggggcctgtgggccgaacgcagcgggatgaccggc
gacctcgccgacacggacctggagcggatctcccgcgccggagtcgccgccctgtcctcc
gccgagggcctcgccctcatggacaccgcctgcgccaccggcgagcccaccgcggtcccc
atgcacctcgacctggccgcactgcgccacgccgacgccgacatggtccccgccctgctg
cgcggcctggtccgccccgccgcgcgccgggccgccgcccagagcgccgcacccgccgac
ggcctcaccgagcggctgctgccgctgaccgcagccgaacgcgaccggctgctgctggcc
accgtccgcgtccaggtcgccgccgtcctcggcttccccggccccgacgcagtcgacccc
ggccgcgccttcaaggaactgggcttcgactcgctcaccgccgtcgagctgcgcaaccgc
ctcggctcggccaccggcgtccggctgcccgccaccctcgtcttcgactaccccaccccg
aacgccctcgccgcgttcctgcgcaccgaactcctcggcgaccaggccgccccggccccg
gccgccaccgccgccgccatccgagccgtcgccgacgagcccatcgccatcgtcgccatg
agctgccgctaccccggcggcgtcagcacccccgaggagctgtggcagctcgtcgccggc
tccgccgacgcgatctcgccgttccccaccgaccgcggctggaacctcgacgcgctgtac
gactccgaccccggccgcgccgggacctcgtacacccgcgagggcggcttcctgcacgac
gccgccgacttcgacccggacgtcttcggcatcaacccgcgcgaggccctggccatggac
ccgcaccagcggctcctgctggaaacctcctgggaggccttcgaacgcgccgggatcgac
ccggccaccgtccgcggcagccgcaccggcgtcttcgccggcgtcatgtaccacgactac
ctgacccggctccctgccgtccccgagggcctggagggctacctcggcaccggcaccgcc
ggcagcgtcgcctccggccgcatctcctacaccttcggcctggagggcccggccgtcacc
atcgacacggcctgctcctcctccctggtcgccctgcacctggccgcgcaggccctgcgc
agcggcgaatgcgacatggccctcgccggcggcgtcaccgtcatgtccaccccggacacc
ttcatcgacttcagccgccagcgcggcctgtccaccgacggccgctgcaagtccttctcc
gccgacgccgacggcaccggctgggccgaaggcgccggcatgatcctcgtcgagcggctc
tccgacgcccgccgcaacggccacccggtcctcgccgtcgtccgcggcaccgccgtcaac
caggacggggcctccaacggcctcaccgcccccaacgggccctcccagcagcgcgtcatc
cgcgaggccctcgcccacgccgggctgaccaccgccgacgtggacgccgtcgaggcccac
ggcaccggcaccaccctcggcgaccccatcgaggcacaggccctgctcgccacctacggc
caggaccgccccgcggaccggccgctgcgcctgggctccatcaagtccaacatcggccac
acgcaggccgcggcgggcgccgccggcatcatcaagatggtgctcgcgatgcgccacggc
gtgctgcccgcgtccctgcacatcggcgagccgtccccgcacatcgactggaccgcaggc
gcggtcgagctgctgacggagtccgccacctggcccgagacggaccgcccgcgccgcgcg
ggcatctcctccttcggcgtcagcggcaccaacgcgcacgtcatcatcgagcagccgccc
gtggagcagccgtccgacgagaaggacggcggcgagcccggcgtccccgccgtcgccggg
ggcacggtccccgccggcaccccgctgccgttcgtcctctccggacgcacccccgacgcg
ctgcgcgcccaggccgcccggctcgccgaccacctcgcgcaccaccccgacgcggccccc
gccgacgtggcgttctccctggccaccacccgtaccgcactcgaccgcagggccgccgtc
gtcgcgcccgaccgcgacggactcctcgccgccctcgccgccctcgccgaaggccgcgac
ggcgcccggatcgtgcggcacgacaccgccgacggccgcaccgccgtcctgttcaccgga
cagggcagccagcgccccggcatgggccgcgagctccacgccacctacccggtcttcgcc
gccgccctcgacgcggtgtgcgccgagctcgaccggcacctcgaacagcccctcaaggag
atcctgttcgacgaggacgccggcgacctcctgaaccggaccggctacacccagcccgcc
ctgttcgccctggagaccgcgctctaccgcctcgtcgagtcctggggcctgcgccccgac
ttcgtcgcgggccactccatcggcgagatcaccgccgcgcacgtcgcgggcgtcctctcc
ctgcccgacgcggccaccctcgtcgccgcccgcggccgcctcatggaagccctgccccag
ggcggcgcgatgatcgcgctgaccgccaccgaggacgaggtccggccgctgctcgccgga
cacgaggaccgcatcggcatcgccgccgtcaactccgcctccagcgtcgtcatctccggc
gaggagaccctcgcgctggagatcgccgccgagttcgagcggcgcggccggcgcaccaag
cggctcaccgtcagccacgccttccactccccgctgatggacggcatgctcgacgccttc
cgcgacgtcgccgcctccctcacctaccacgcgcccgccatccccgtcgtcacccacctc
accggagccgtggccggcgacgaactgcgcaccgccgagcactgggtgagccacgtccgc
gaagccgtccgcttcctcgacggcatccgcaccctggacgccgaacacgtcaccacctac
ctcgaactgggcccgcagggcgtgctgtccggcctcggccgcgactgcctcaccgagacc
gacggcgccaccgaccccctcttcgtccccgccctgcgccgcgaccgcggcgaggccgag
gcgctgaccgcggcgatcgccgccgtccacacccgcgccgtccccctcgactggcccgcg
tacttcgccgcgaccggcgcccgccgcgtcgacctgcccacgtacgccttccagcggacc
cgcttctggctcgaagcgcccgccggatacatcggggacgtcgaatcggccggtctgggc
gccgcccaccacccgctgctcggcgcggcagtcccgctcgccgacggcgagggcttcctc
ttcaccggccggctctccctcgacacccacccctggctggccgaccacgccgtcatgggc
accgtcctgctgcccggcaccgccttcgtcgaactcgccgtccgcgccggcgaccaggcc
ggctgcgacgtcctggaagaactcaccctcgaagccccgctggtcctcgccccgcacacc
gcggtccgcctccagatcgtcgtcagcgcacccgaccaggacggccggcgcaccctggac
ctttactccggcgaccccgacgccgccgacgacgagccgtggacccggcacgccgcgggc
gtcctcgccaccggcgcgccgcgccccgcgttcgacctcgccgcctggcccccgccgggc
gccgaagccgtcagcgtcgacggcctgtacgagcacctcggccagggcggattcgcctac
ggccccgtcttccagggcctgcgcgccgcctggaccctcggcgacgacgtctacgccgag
gtggccctgcccgacgaccggcacaccgaagccacccgcttcggcctgcacccggccctc
ctcgacgccgccctgcacgccaccttcgtctcccaagacggcgaccggcaggccggactg
ccgttctcctggcgcggggtgtccctgcacgccgtcggcgcgtccgcgctgcgcgtgcgc
ctcaccgccgacggcgacgactccctctccctccagctggccgacaccaccggcgcgccc
gtcgccaccgtcgaccacctgatcgtccggcccgtctccgccgaccggctcgccggcgcc
tcccgcaccgcgtaccacgagtcgctgttccgggtcgaatgggcgaccctgcccctgccg
cccggcgcccccggcgaggacaccaccggcacctgggcggtcatcggcgaacccgccgac
gtcaccgccgagctgcccggccccgtccaccccggcctcggcgcgctcggcgcggccctc
gacgcaggcgccccggcgcccgcacacgtcctcgccccctgcctggccgccccggcggaa
gccctcaccgcggacgccgtccgcgccgccacgcaccgggccctcgccctcgtccagggc
tggctcgcagacgaccggttcgccgcgtcccgcctggtcttcgtcacccgcggcgccgtc
gccacccagagcgactgggacctcgccgaccccgcccacgccgccgtctggggcctggtc
cgctccgcgcagtcggagaaccccgaccgcttcgtcctggccgacctcgacgccgacgcc
gccgccgggacactggccgccgccctcgccaccggcgaaccgcagttcgcactccgccgc
ggcaccgtccacgccccccgcctcgcacgggtccccgccaccaccccgctgaccccgccc
cccggcgagtccgcctggcgcatggacatcgaggacaagggcaccctcgaccacctcacc
ctcgtcccgagccccgagtccgcggcgcccctggaacccggccaggtccgcgtcgccgta
cgcgccgccggcctcaacttccgcgacgtgctcaacgccctcggcatgtaccccggcgac
cccggcctcatgggcagcgaaggcgccggcaccgtcgtcgagaccggccccggcgtcagc
gacctcgcccccggcgaccgcgtcatgggcatgctgcccggagccttcggcccgctggcc
gtcgtcgaccggcgcatgatcgccccgatgcccgagggctggaccttcgccgaggccgcg
gccgtaccgatcgtcttcatgacggcctactacgccctccacgacctcgccggactgcgc
gagggcgaatccctcctcgtccacgccgccgccggcggcgtcggcatggccgccgtccag
ctcgcccgccactggggcgccgacgtctacgccaccgccagccccgccaagtgggacacc
ctgcgcggactcggcctgaccgacgacaagatcgcctcctcccgcaccctcgacttcgag
aacaccttccgcaccgccaccgacggccacggcgtcgacgtcgtcctcgactccctcgcc
cgcgagttcgtcgacgcctcgctgcgcctcctgccgcgcggcggacgcttcgtcgagatg
ggcaagaccgacgtccgcgacccccgcgacgtcgccgccacccaccccggcgtctcctac
caggcgttcgacctcaccgaagccggcctcgaccgcatccaggagatgctcaccgagctg
ctcggcctcttcgaagccggcgccctgaaccccatcccggtctccgcctgggacctgcgc
caggcccccgaagccttccgctacctcagccaggcccgccacaccggcaagatcgtgctc
accgtgccggccgactggaaccccgacggcaccgtcctcatcaccggcggcaccggcacc
ctcggcgcattcgtcgcccggcacgccgtcaccgtccgcggcgcccgccgcctcatcctg
accagccgccgcggcgaagccgccgccggcgccgccgaactcgccgcgcaactgcgcgcc
ctgggcgccgacgtcaccgtcgccgcctgcgacgccgccgaccgcgaggccctcgccgca
ctgctggcctccatacccgccgcgcacccgctgaccgccgtcgtccacaccgccggcgtc
ctcgacgacggcatcgccgaggccctcacccccgagcggctcgaccgggtcctgcggccc
aaggccgacgccgccctccacctgcacgagctgacccgccacctcgacctggccgacttc
gtcctcttctcctccgccgccggcaccttcggcggcgcgggccaggccaactacgcggcc
gcgaacgtcttcctcgacgccctcgcccgccaccgccaggcccacggcctgcccggcacc
tccctcggctggggcctgtgggccgaggccagcggaatgaccggcgaactcgacagcgcc
gacaaggaccgcatgacgcgctccggagtcctcggcctctcctccgaggagggcctcgcc
ctcctcgacaccgcccaccacaccggcgacgcccacctcgtccccatgcagctcgacctc
gcgccgctgcgccaggcagacgccgccatggtgcccgccctgctgcgcggcctggtccgc
gcccccgcccgccgcaccgcccaggcggccaccgccgggaccggaaccccgctggtggag
cagctcgtacgcctccccgagaacgagcgcgacacgctcctcctcgacctcgtacgcgac
caggtcgccgccgtcctcggccacgccacctccgacgccgtcgaacccggccgcgccttc
aaggacctcggcttcgactcgctgaccgccgtcgagttccgcaaccggctcggcgccacc
gccggagtccggctgcccgccaccctcgtcttcgactaccccacccccacggtcctcgcc
ggctacctcaaggacgaactcctcggctccgaggccgcggtggccgccgccgccctcccg
cggcacccggccggcgccgtcgccgagaccgacgaccccatcgccatcgtcgccatgagc
tgccgcttccccggcgacgtccgcagccccgaggacctgtgggaactcctcgccgaaggc
cgcgacggcatcgccgacctccccgccgaccgaggctgggacaccgaggcgctctacgac
cccgaccccgacagccccggcacgtcctacgcccgcgaaggcggcttcttctacgacgcc
caccacttcgacccggcgttcttcgggatcaacccccgcgaggccctcgccatggacccc
cagcagcgcctgctgctggaaacctcctgggaggccttcgaacgggccgggatcgacccg
acgggcctacgcggcggacaggtcggcgtgttcgtcggccagatgcacaacgactacgtg
tcccgcctgaacaccgtgcccgaaggcgtcgagggctacctcggcaccggcggctccagc
agcatcgcctccggccgcgtctcctacaccttcggcttcgagggcccggccgtcaccgtc
gacaccgcctgctcctcctcgctggtcgccctgcacctcgcggcgcaggccctgcgctcc
ggtgagtgctccctggccctggccggcggcgtcaccatcatcaccacccccgacgtcttc
accgagttcagccgccagcgcggactcgccgccgacggccgctgcaagccgttcgcggcc
gccgccgacggcaccgcgtggggcgagggcgtcggcatgctgctcgtcgaacgcctctcc
gacgcccgccgcaacggccaccaggtactcgcggtcgtccgcggcaccgccgtcaaccag
gacggcgccagcaacgggctgaccgccccgaacggccccgcccagcagcgcgtcatccgc
caggccctcgccaacgcccggctgacctccgccgacgtcgacgccgtcgaggcgcacggc
accggcaccaccctcggtgaccccatcgaggcacaggcgctgctggccacgtacggtcag
ggccgtcccgaggacaccccgctgtggctgggttccgtcaagtccaacttcgggcacacc
caggccgccgcgggcgtcgcgggcatcatcaagatggtccaggcgatgcgccacggcgtc
ctgccgaagaccctccacgtggacgagccgtcaccgcacgtcgactggtcggcgggcgcg
gtctccctgctcaccgagcagcgggcatggcccgagaccggccgcccgcgccgcgcgggc
gtctcctccttcggcatgagcggaacgaacgcccacgccatcatcgaactcccggagacc
cctgccgcagcggtcagcccggccgtcccggcccccgcgacggccctcccgtggcacctg
agcgcccgcacccccgaggccctgcgggcccagggcgagcagctcctgtcccacctggag
gcgcacccggacacgctcccggccgacatcggccactcgctggtgaccgcccgcgccgtg
ttcgaacaccgcgcgacggtcgtcgccaccgaccccgacgccttccgcaccggcctggcc
gccctcgccgagggccgctcggcggcgggcctggtccagggctcgtcggccgcggcgggc
aagctggccttcctcttcacgggacagggcagccagcggctcgggatgggccgggagctg
tacgagacctacccggccttcgcggccgcgctggacgcggtgtgcgacgcgctggaactg
ccgctgaaggacgtcctgttcgggacggacgcggatgttctggaccgtacggagtacacg
cagctcgcgctgttcgcggtcgaggtggcgctgttccgcctcgtcgagtcctggggtgtg
aagccggacttcctgtccgggcactccatcggtgagatcgccgccgcgcacgtcgcgggt
gtcctctcgctggccgacgcgtgcacgctggttgcggcgcgcggccgtctgatgcaggcg
ctgccgtccggtggcgtgatgatcgcggtggaggctgcggaggaagaggtcctgccgctg
ctgacggaccgggtgagcatcgccgccgtcaacggcccgcgctcggtggtcatcgccggt
gacgaggacgcggcgctcgctctcgtggccgcgttcgccgaccggaagaccaagcggctg
accgtcagccacgcgttccactcgccgcacatggacgggatgctcgacgacttccgcgag
gtggtggcggggctgtcgttcgccgcgccccgtatcccggtcgtctcgaacctgaccggc
gccctcgtcaccgacgagatgggttcggccgagttctgggtccggcacgtccgtgaggcc
gttcgtttcctcgacggcgtccgcgcccttgaggcggcgggcgtgaccacgtacgtcgag
ctcggtcccgacggggtcctctccgcgatggcccaggcctgcctgaccgacgacaccggc
gccgccgccttcgcccccgcgctccgctccggacgcgacgagcccacgaccctgctctcg
gccctctccaccgcgtacgtacgcggcacggccgtcgactggtccgcgtactacgccccg
ctcggggccgggcgcgtcgacctgccgacctacgccttccagcgctccgtctactggctc
gacgccggccgcgccgacggcgacgtcgcggcggccggactcggcgccgccgaccacccg
ctgctcggcgccgaggtccagctgcccgactccgacggccacctcttcaccggacggctg
tccctgaccacccacccctggctgggggaccaccgggtgatgggcgcggccctcctgccc
ggtacggccttcgtcgagctcgcgctccaggccggcgagcacgtcgggtgcgacctggtc
gacgaactcaccctggaggcacccctcgtcctgcccgagcacggtggcgtgcagctgcgg
ctctccgtcgcggccgccgacccggcgggccgacgccgcagcctcaccctgcactcccgc
cccgagggcgcggacgcggacgagccgtggacgcggcacgccgtaggtgtgctcgcgacc
ggggccgccccgaccccgcagggcctcaccgaatggccgcccgccggcgctgagcccgtc
ccggtggacggcctgtacgagggcctcgccgaggccggtttcggatacgggccggtgttc
cagggcctgcgggccgcctggcagcacggcgacacctcctacgcggaggtcgcgctcccc
gagggagcggagggggaggctgcacggttcggtctgcacccggcgctcctcgacgcggcc
ctgcacgcgctcggactgcgcgccgcggacaccggcgccgacggacggctcccgttctcc
tggtccggggtctccctgcacgccgtcggagcctgcgagctccgggtacgcctgaccacc
ggcctgggcggcgaggtggccctcacgatcgccgacgccaccggagcgcccgtcgcctcg
gtcgccggcctggccctgcgatccgtcagccgtgaccagctcaccgccgcgcccgacctg
acccgtgacgccctgttccgggtggagtgggcgcagacgaccgcaggtgacgggtccttc
gacgactggctgatgctgggcgaggagggcgatggcgcccttccggcggcgctggtggtg
ccgtgcgtggagccggccgccggtgacgtggccggcgcggtgcacgcggagaccgcccgg
gtgctggggctggtacaggactggctggccgaggagcggtccgcggacgcgcgtctggtg
ttcctgacgcggggcgcggtggccgccgtaccgggcgaaggaatcgcggatctggcgcac
gcgccggtgtggggcctggtgcgctccgcgcagtcggagaacccgggccgcttcgtcctc
gtcgacatcgacgcggagggcgacctcgcggccggtctgtcggcggcgctggcttcgggt
gagtccgaggtcgcggtgcggggtggctcggtcctggtgccgaggctggcgcgtacggcg
gtggctgctgacgcgggtgctgagtgggatgccgggggcacggtcctggtgaccggtgcg
agtggttcgctgggcgggctgttcgcgcgtcatctggtggcggagcacggtgtacggcgt
ctgctgctggtgagccgtcgcggtgagggcgctgccctttccgctgagctcgccggtctg
ggtgccgaggtgtcgtgggccgcgtgtgacgtggccgaccgcgatgcgctggcggccgta
ctcaaggcggttcctgcggagcacccgctgacggcggtcgtacacacggccggtgtcctg
gatgacggtgtggtcggttcgctgaccaccgagcgcctgtcggccgtcctgcgtccgaag
gtggatgctgcctggaacctgcacgagctgacgcaggacctcggtctgtcggccttcgta
ctgttctcctccgccgccggtgtctttggcggtgcgggtcaggccaactacgcggcgggc
aatgtgttcctcgacgcgctggccgcgcaccgccgggcccagggcctggccgcgacctcc
ctggcctggggcctgtggaccggagtcggcggcatgggcggcgacctggccgacggtgac
cgcgagcggatcaaccgcggcggcatcggcgccctctcgccggagaccggcctcgcgctc
ttcgacgcggcccgccgtaccgacgacgcgctgctggtgcccctcccgctcgacctggcc
gccctccgcgcccaggcccgggccggcacggttcccgacctgctgcgcgggctggtccgc
gtaccggcgcgccgcgcggcgggacagggggccacggccgacgggtccgccctgcgcacg
cggctggccgcgctgcccgccgaggagcgggaggcggccctgctggagatggtccgggcc
gaggtgacggccgtactcgggcacgcctcgaccgacgaggtaccggccgaccgggcgttc
aaggagctcggcttcgactccctgacctccgtcgagctgcgcaaccgcctcggcgccgcc
accggcgaacggctgcctgccacgctcgtcttcgactaccccacgccgagcgcgctcgcg
gcgtacctgaggaccgaggtcctgggcctgtccctggacgaggagacggccggcgcggcc
acggccgggcccgcttccgccggtgccgcgctccaggacgaccccatcgcgatcgtcggc
atgagctgccgctaccccggcggggtggaaacccccgaggacctgtggcgcctggtggtg
ggtggcgtcgatgccatctcggagttcccgcagggccgcggctgggacctggagtcgctg
tacgacccggacccggacggcaagggcaccagctacacccgctccggcggattcctgcac
gacgcgggccgcttcgacccggcgttcttcgggatctcgccgcgcgaggccgtggccatg
gacccgcagcagcgcctgctgctggagacctcgtgggaggccttcgagcgggccggcatc
gacccggcttcgatgcgcggcagccggaccggtgtcttcgccggcgtcatgtaccacgac
tacgccacccgcatcacctccgtgccggacggtgtcgagggctacctcggcaccggcaac
tccggcagcatcgcctcgggccgcgtctcgtacgccttcggcctggagggcccggcggtc
accgtcgacacggcctgctcctcctccctcgtcgccctgcactgggcgatccaggcgctg
cggggcggcgaatgcaccatggccctggccggcggtgtcaccgtcatgtcgacgcctggc
accttcaccgagttcagccgccagcgcgggctggccgccgacggccgcatcaagtccttc
gccgcggccgccgacggcaccagctgggccgagggcgcgggcatgctgctcgtcgagcga
ctgtcggacgcccgccgcaacgggcacccggtgctcgccgtggtccggggctccgcgatc
aaccaggacggcgcctccaacgggctgaccgccccgaacggcccctcgcagcagcgcgtc
atccgccaggcgctcgcctccggcggactgaccagcgagcagatcgacgtggtcgaggcg
cacggcacgggcaccaccctgggcgacccgatcgaggcgcaggcgctgctggccacctac
ggccgggagcgcgcggcggacgagccgctgtggctgggttcgatcaagtccaacatgggc
cacacgcaggccgccgcaggagtcgccggcgtgatcaagatgatcatggcgatgcggcac
ggggtgctgccccggaccctgcacgtggacgagccgaccccgcacgtggactgggaggac
ggcgccgtcacgctgctcaccgagaacacgccgtggccgcagaccggccgcccgcgccgg
gccggtgtgtcctcgttcggcatcagcggcaccaacgcccacacgatcatcgagcaggcc
ccggacgcggtcgccgtgagcgccgccgccgaaagcggtgcggcggccccggtgctgccg
tacgtgctgtccgcgcggtcggcggacgcgctgcgcggccaggcggcccgtctgcgggtg
cacctggaggactcggccgagctgagcgtcacggacgtggcctactcgctggcgacccgg
cgcgccgccttcgaccaccgcgcggtggtcgtggcgggcgaccgcgaggaactgctgcgc
gggctggaggcgctggggaacaacgacctggccgacgcggccgtgacgcgtggcacggtg
ggcgccgccggtgccgggaagctcgccttcctgttcaccggtcagggcagccagcgcctc
ggcatgggccgcgagctgtacgaggccttcccggccttcgcggccgcgctggacgcggtc
tgcgagcggatggacctcgaactgcccctgacggacgtcctgttcgggacggacgcggat
gtcctggaccgtacggagtacacgcagcccgccctgttcgccgtcgaggtggcgctgtac
cgcctcgtcgagtcctggggtgtcaagccggacttcctgtccgggcactccatcggtgag
atcgccgccgcgcacgtggcgggcgtcctctccctggaggacgcgtgcgaactggtccgc
gcccgtgggcggttgatgcaggcgctgccgtccggtggcgtgatgatcgccgtccaggcg
tccgaggaggaggtcctgccgctgctgacggaccgggtgagcatcgcggccgtcaacggc
ccgcgctcggtggtcgtcgccggtgacgaggacgcggcgctcgcgatcgccggggccttc
cccgaccggaagtccaagcggctgacggtgagccacgccttccactcgccccacatggac
ggcatgctggccgacttccgcaaggtcgccgaggcactctcgtacggcgccccgcgcatc
ccggtcgtctccaacctgaccggcgcgctcgtcaccgacgagatgggctccgccgacttc
tgggtccggcacgtccgcgacgccgtccgcttcctcgacggcatccgcaccctggaagcc
gccggagtcacgacgtacctcgaactcggccccgacggagtgctctccgcgatggcccag
gactgcctgaccgaggacggcgcccggttcgcgcccgccctgcgcaccggccgccccgag
cccgagaccctgaacaacgccctcgcccacgcccacgcccacggcgcggcggtggactgg
gaggcctacttcgcgcccaccggcgcccgccaggccgagctgcccacgtacgccttccag
cgcgactggtactggctcgactcggcacccaccgcgcacaacacccccggcgacgccgcg
ggcttcggcctcggcgcgacggaccacccgctgctcggcgcggccgtcgaactgccggac
tccgacgggttcctcttcaccggccggctgtccctggccacgcacgcatggctcgcggac
cacgccgtcctcggctcggtcctcctgccgggcacggccttcgtggaactggccgtccgc
gccggggaccaggtcggctgcgacgtcctggaggaactgaccctggaggccccgctcgtc
ctccccgaacgcggcggagtccagctgcggctctccgtcgccgaagccgacgaatccggc
cgacgcgccctgtcgctttactcccgcgacgaggacacccccgccgacgagccgtggacg
cggcacgccgccggcgtcctcgccaccggcgacgccccggccccggcagccgacctcacg
gtctggcctccggccggagccgaaccggtggacatcgacggcctctacgaaggcctcgcc
gccgccggattcgactacggccccgccttccagggcctgcgctcggcctggctccacggc
gacgccgtgtacgcggaggtcagcctggacgaggagaccgcggaggcggccgactggttc
ggcctccacccggcgctcctggacgccaccctccacgcggccggtctcggcgcgctcgtc
gagaagaccggccagggacggctcccgttcgcctggagcggtgtccggctgcacgcggcc
ggcgccggcgccgtacgggtccggctggccccggccggccgcgacgcggtcgcgctggag
ctcgccgacccggcgggcgcaccggtcgcctcggtcgagtcgctcgtactgcgcgcggtc
tcgccggagcagatcggcgcggcgcgcggcggtcgcccggagtcgctgttcgaggtcgag
tggacggccgtaccgctgaccccggtgtcggcgtcggagcagagcccctgggcgctgctc
ggggacggccacgccggtctggacgcggtgggcgtgcgctacacggcgcacgacggcggg
ctcgcgacgctcgcggacccggcgctggtgtgcgtaccgctgtccccggtgtccggcacg
gaagacgtcacgggtgcggtgcacgcggagacgggccgggtgctggcgctgctcaaggag
tggctggccgaggagcggttcgcggactcgcgcctggtgttcctgacgcggggcgcggtg
gaagccgtaccgggcgaaggcgtaccggacctggtgcacgcatcggtgtggggtctgctg
cgttcggcgcagtcggagaacccgggacggatcgtcctggccgacacggacggcaccgac
gcctccttccgcgcgctgcccgccgtggtcgcctcgggtgagtccgaggtggcggtgcgg
ggcggctcggtcctggtgccgaggctggcgcgtgcggcggtggctgctgacgcgggtgct
gagtgggatgccgagggcacggtgttgatcaccggtgcgagtggttcgctgggcgggctg
ttcgcgcgtcatctggtgaccgagcacggtgtacggcgtctgctgctggtgagccgtcgc
ggtgagggcgctgccctgtcggcggaactcgccggtctgggtgccgaggtgtcgtgggcc
gcgtgtgacgtggccgaccgcgatgcgctggcggccgtactcaaggcggttcctgcggag
cacccgctgacggcggtcgtgcacacggcgggcgtgctggatgacggcgtcgtcggttcg
ctgacggccgagcgcctgtcggccgtgctgcgtccgaaggtggacgcggcgtggaacctc
cacgagctgacccaggatctggatctctccgcgttcgtgctgttctcgtccgccgccggt
gtgttcggtggcgcgggccaggccaactacgcggcgggcaatgtgttcctcgacgcgctg
gccgcgcaccgtcgggcccagggcctggcggcgacctccctggcctggggcctgtgggcc
gaagccggcggtatgggtggcggactggacgccgaggacgtgtcccgtctgggccgtggt
ggtgtcgatgccatcaccgctgccgagggtgtggcgttgttcgatgccgccacctccgcc
gagcaggcgctgctggtgccggtgaagctggacctggccgccctgcgcgcccaggccggc
tccgggatgctcccgccgctgctgtcgggcctggtgcgtacccccgcacgccgcgccgcc
ggtaccaccgctgccggtacggacggcggagccgagctgcgcgagcgcctcaccgggctc
tcgccggccgcgcgggacgaggcactgctggaactggtctgcggctacgtcgccggggtc
ctcggcttcgccggaccggaagcggtcgacccggcacggtcgttcaacgaggtcggcttc
gactcgctgaccgccgtcgagctgcgcaaccggctcggcgccgccaccggcgtccggctg
cccgccaccctcgtcttcgactacccgacgccgacggcgctggtggagtacctgaaggac
gagctgtggcaggacggcgcggcggccgtacccccgctgctcgccgaactggaccgcctg
gagaagtcgctcgtcacctcgacgcccgacggcgccggccgcgaccgcatcaccgagcgg
ctccaggcgctgctggccgcctggagcgaggccggtgaactcgcggcagctcccgcggac
tccgacggccccgacgtggccgaggcactggagagcgcgaccgacgacgacctcttcgac
ttcatcggcaaggagttcggaatctcatga

DBGET integrated database retrieval system