KEGG   Streptomyces sp. Mg1: M444_06085Help
Entry
M444_06085        CDS       T03958                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00260  Glycine, serine and threonine metabolism
strm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M444_06085 (tdh)
Enzymes [BR:strm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     M444_06085 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C FAD_binding_3 Methyltransf_25 HI0933_like FAD_binding_2 Pyr_redox_3 FAD_oxidored ADH_zinc_N_2 Pyr_redox_2 Methyltransf_11 2-Hacid_dh_C 3HCDH_N Pyr_redox I-EGF_1
Motif
Other DBs
NCBI-ProteinID: AKL65029
UniProt: B4VBD3
LinkDB All DBs
Position
1:complement(1508292..1509320)
Genome map
AA seq 342 aa AA seqDB search
MKALVKHKAEPGLWLMDVPEPEYGPGDVLIKVLRTGICGTDLHIRAWDGWAQGAVKTPLV
LGHEFVGEVAALGADVQDIEIGALVSGEGHLVCGKCRNCLAGRRHLCRSTIGLGVGRDGA
FAEYVVLPAQNVWVHRTAVDLDVAAIFDPFGNAVHTALSFPLVGEDVLITGAGPIGIMAA
AVAKHAGARNVVITDVSPERLEIARKAGATLAVDVRNTTIADAQARLGLREGFDIGLEMS
GRAEAMQDMIANMTHGGRIAMLGLPAQDFPVDWAKVVTSMLTIKGIYGREMFETWYAMTV
LLEGGLDLSPVITGRYAHTEFEAAFDEASTARSGKIILDWTA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcgtcaagcacaaggccgagcccgggctgtggctcatggacgtccccgag
cccgagtacggccccggcgacgtgctgatcaaggtgctccgcaccggcatctgcggaacc
gacctccacatccgcgcctgggacggctgggcgcagggcgcggtcaagaccccgctcgtc
ctcggccacgagttcgtcggcgaggtcgcggcgctcggcgcggacgttcaggacatcgag
atcggcgcgctggtcagcggcgagggccacctggtgtgcggcaagtgccgcaactgcctg
gccggacgccgtcacctgtgccgcagcacgatcgggctcggcgtcgggcgcgacggcgcc
ttcgccgagtacgtggtcctgcccgcgcagaacgtgtgggtgcaccggaccgccgtggac
ctggacgtggcggcgatcttcgaccccttcggcaacgccgtgcacaccgcgctgtcgttc
ccgctggtcggcgaggacgtgctgatcaccggcgcgggcccgatcgggatcatggcggcg
gccgtggccaagcacgccggtgcgcgcaacgtcgtcatcaccgacgtcagccccgagcgg
ctggagatcgcccgcaaggcgggcgccacgctcgcggtggacgtccgcaacaccacgatc
gccgacgcgcaggcgcggctggggctgcgcgagggcttcgacatcggcctggagatgtcg
ggccgcgccgaggcgatgcaggacatgatcgcgaacatgacgcacggcggccgcatcgcg
atgctgggcctgcccgcgcaggacttcccggtcgactgggccaaggtcgtcacctcgatg
ctcaccatcaagggcatctacgggcgcgagatgttcgagacctggtacgcgatgacggtg
ctgctggagggcggcctggacctcagccccgtcatcaccggccggtacgcgcacacggag
ttcgaggccgccttcgacgaggcgtcgaccgcccgcagcggcaagatcatcctcgactgg
accgcgtaa

DBGET integrated database retrieval system