KEGG   Streptomyces sp. Mg1: M444_14595Help
Entry
M444_14595        CDS       T03958                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
strm  Streptomyces sp. Mg1
Brite
KEGG Orthology (KO) [BR:strm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:strm01001]
    M444_14595
Enzymes [BR:strm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     M444_14595
Protein kinases [BR:strm01001]
 Serine/threonine kinases: Other
  Bacterial family
   M444_14595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_19 TPR_16 APH TPR_MalT TPR_14 Kdo ANAPC3 BTAD Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AKL70034
UniProt: A0A0G3UUV4
LinkDB All DBs
Position
1:complement(3433331..3434824)
Genome map
AA seq 497 aa AA seqDB search
MIGERYQLATILGQGGMGQVWTAYDRRLDRRVAVKLLRPDKVAGPGTVAEELRRRFVREC
RVTAQVDHPGLVTVHDAGSDGDELFLVMGYVEGSDLADHLAEHGPYPWQWAVSVVAQLCG
VLSAVHAVPIVHRDLKPRNVMIRPDGTVLVLDLGVASVMDTDTTRLTSTGSPIGSPAYMA
PEQAMGGAVGPYTDLYALGVLLYELLSGNVPFAGSTALGVLHRHLYEPPVPVRRLRPEVP
HQLEVILLHLLAKDPQDRPGSAQEVYQALVPLLPQQGAPSGPLDPTRPFLRPQAPWPDRA
TVIPPQPTQPPDPQRPDIPAAVDEARQLLDQGLLTQAVDILGGILPAAAAQHGEHSPVVR
SLRKQYAATLMDDGQYRRALPELRRLTDEFPPGDPQSHRFRYDAAQCLEQLGEPAAALAE
YRSLLPLFENHYANPDPGLPLEVRRRIAHLLLSLGDRPAAHDTLARLLFDAERLHGPNHP
FPAEVRRTLHWLGQVRG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atcatcggcgagcgctaccagctcgccaccatcctgggccagggcggcatgggccaggtc
tggacggcgtacgaccggcgcctggaccggcgcgtggccgtcaagctgctgcgccccgac
aaggtcgcgggccccggcaccgtcgccgaggagctgcgccgccgcttcgtccgcgaatgc
cgggtcaccgcgcaggtggaccaccccgggctggtcaccgtccacgacgcgggcagcgac
ggggacgagctcttcctcgtcatgggctacgtcgagggctccgacctcgccgaccacctc
gccgagcacggcccgtacccctggcagtgggcggtctccgtcgtcgcgcagctgtgcggc
gtgctgtccgcggtgcacgcggtgccgatcgtccatcgtgacctgaagccccgcaacgtg
atgatccgccccgacggcaccgtgctcgtcctggacctcggtgtcgcctccgtgatggac
accgacaccacccgcctcaccagcaccggctcacccatcggcagccccgcctacatggcg
cccgagcaggccatgggcggcgcggtcggcccgtacaccgacctgtacgcgctcggtgtc
ctgctgtacgaactcctcagcggcaacgtcccgttcgccggatccaccgcgctcggcgta
ctgcaccgccacctgtacgagccgccggtgccggtgcgccggctgcgcccggaggtcccg
caccagctggaggtgatcctgctgcacctgctggccaaggacccgcaggaccggcccggc
tccgcccaggaggtctaccaggcgctcgtcccgctgctcccccagcagggcgcgccgtcc
gggccgctcgatcccacccgccccttcctgcgcccgcaggccccctggccggaccgcgcg
acggtgatcccgccgcagcccacgcagccgccggacccgcagcgcccggacatcccggcc
gccgtggacgaggcccgccagctgctggaccagggcctcctcacccaggccgtggacatc
ctcggaggcatcctcccggcggcggccgcgcagcacggggagcactcgccggtggtccgc
tcgctgcgcaagcagtacgccgcgacgctgatggacgacggccagtaccgccgggcgctg
cccgaactgcgccgcctcaccgacgagttcccgcccggggacccccagtcgcaccgcttc
cgctacgacgcggcccagtgcctggagcagctcggcgaaccggcggccgccctcgcggag
taccgctcgctgctgccgctgttcgagaaccactacgccaacccggacccgggcctgccg
ctggaggtccgccgccggatcgcccacctgctgctgtccctgggggaccggccggcggcc
cacgacaccctggcccggctgctgttcgacgccgagcggctgcacggcccgaaccacccg
ttcccggcggaggtccgccgcaccctgcactggctggggcaggtcaggggctga

DBGET integrated database retrieval system