KEGG   Streptomyces sp. Mg1: M444_14710Help
Entry
M444_14710        CDS       T03958                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00620  Pyruvate metabolism
strm00680  Methane metabolism
strm01100  Metabolic pathways
strm01120  Microbial metabolism in diverse environments
strm01200  Carbon metabolism
Module
strm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:strm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M444_14710
  Energy metabolism
   00680 Methane metabolism
    M444_14710
Enzymes [BR:strm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M444_14710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKL66445
UniProt: B4VA54
LinkDB All DBs
Position
1:complement(3460677..3463439)
Genome map
AA seq 920 aa AA seqDB search
MSSADQAPSTSATASGAEAANAELRADIRRLGDLLGETLVRQEGQDLLDLVERVRALTRT
DGIAAAELLGDTDLETAAKLVRAFSTYFHLANVTEQVHRGKELRAHRAAEGGLLARTADM
LKDADPEHLRQTVKNLNVRPVFTAHPTEAARRSVLNKLRRIAALLEEPAAGAGERRRHDL
RLAENIDLVWQTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLAAELQRVGVELP
PGTRPLTFGTWIGGDRDGNPNVTPDVTRDVLILQHEHGITDALELVDFLRGLLSNSIRYT
GATEELLASLQADLERLPEISPRYKRLNAEEPYRLKATCVRQKLVNTRERLAKGTPHEEG
RDYLGTAELLTDLTLIQTSLREHRGALFADGRMDRTIRTLAAFGLQLATMDVREHADAHH
HALGQLFDRLGEESWRYADMPRDYRGKLLAKELRSRRPLAPTPAPLDAAGQKTLGVFFAI
KDAFEKFGPEVIESYIISMCQGADDVFAAAVLAREAGLLDLHAGWAKIGIVPLLETTDEL
RAADVILDEMLADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVA
HRYGVRLRLFHGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLAR
ENLELTVAATLQASALHTAPRQSDDDLARWDAAMDTVSDAAHGAYRALVEDPDLPAYFFA
ATPVDQLADLHLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALRE
AGGEHALTEMGERWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFDRIQAEHE
LTVREVLRITGGRQLLDSNPVLQQTFAVRDAYLDPISYLQVSLLARQRAAAERGEEADPL
LARALLLTVNGVAAGLRNTG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgctgaccaggccccctccacctccgccacggcatccggcgccgaagccgcg
aacgccgagctgcgcgcggacatccgccgcctcggcgacctcctcggcgagaccctcgta
cgccaggagggccaggacctcctcgacctcgtcgaacgcgtccgcgccctcacccgcacc
gacggcatcgcggcagccgagctgctcggcgacaccgatctggagaccgccgccaagctg
gtgcgcgccttctccacctacttccacctcgccaacgtcaccgagcaggtgcaccgcggc
aaggagctgcgcgcccaccgcgccgccgagggcgggctcctcgcccgcaccgccgacatg
ctcaaggacgccgaccccgagcacctgcgccagacggtcaagaacctcaacgtccgcccc
gtcttcaccgcgcaccccaccgaggcggcccgccgcagcgtcctcaacaagctgcgccgc
atcgccgccctgctggaggagcccgccgccggcgccggcgaacgccgccgccacgacctg
cgcctcgccgagaacatcgacctcgtctggcagaccgacgagctccgcgtcgtgcgcccc
gagcccgccgacgaggcccgcaacgccatctactacctcgacgagctgcacgccggcgcc
gtcggggacgtactggaggacctcgccgcagagctccagcgcgtcggcgtcgagctgccc
cccggcacccggcccctcaccttcggcacctggatcggcggcgaccgggacggcaacccc
aacgtcacccccgacgtcacccgcgacgtgctgatcctccagcacgagcacggcatcacc
gacgccctcgaactcgtcgacttcctgcgcgggctgctgtcgaactcgatccgctacacc
ggcgccaccgaggaactcctcgcctccctccaggccgacctggagcgcctccccgagatc
agcccgcgctacaagcggctgaacgccgaggagccgtaccgcctcaaggcgacctgcgtc
cgccagaagctcgtcaacacccgcgaacgcctcgccaagggcaccccgcacgaggaaggc
cgcgactacctcggcaccgccgagctcctcaccgacctcaccctcatccagacctccctg
cgcgaacaccgcggcgccctcttcgccgacggccgcatggaccgcaccatccgcacgctg
gccgccttcggcctccagctcgcgaccatggacgtacgcgaacacgccgacgcccaccac
cacgccctcggccagctcttcgaccggctcggcgaggagtcctggcgctacgcggacatg
ccgcgcgactaccgcggcaagctcctcgccaaggaactgcgctcccgccgcccgctggcc
cccacccccgcgcccctcgacgcggccggccagaagaccctcggcgtcttcttcgccatc
aaggacgccttcgagaagttcggccccgaggtcatcgagtcctacatcatctcgatgtgc
cagggcgccgacgacgtcttcgccgccgccgtcctcgcccgcgaggccggcctcctcgac
ctgcacgccggctgggccaagatcggcatcgtcccgctcctggagaccaccgacgagctg
cgcgccgccgacgtcatcctcgacgagatgctcgccgacccctcctaccggcgcctggtc
tccctgcgcggcgacgtccaggaggtcatgctcggctactccgactcctccaagttcggc
ggcatcaccaccagccagtgggagatccaccgcgcccagcgccggctccgcgacgtcgcc
caccgctacggcgtgcggctgcgcctcttccacggccgcggcggcaccgtcggccgcggc
ggcggcccctcgcacgacgcgatcctcgcccagccctggggcaccctcgaaggcgagatc
aaggtcaccgaacagggcgaggtcatctccgacaagtacctcgtcccctccctcgcccgc
gagaacctcgaactgaccgtcgccgccaccctgcaggcctccgccctgcacaccgcgccg
cgccagtccgacgacgacctcgcccgctgggacgcggccatggacaccgtctccgacgcg
gcccacggggcctaccgcgcgctcgtcgaggacccggacctgcccgcgtacttcttcgcc
gccacccccgtggaccagctcgccgatctgcacctcggctcccggccctcccgccggccc
gactccggcgccgggctcgacggcctccgcgccatcccgtgggtgttcggctggacccag
tcccgccagatcgttcccggctggtacggcgtcggctccggcctcaaggccctgcgcgag
gcgggcggcgagcacgccctcaccgagatgggagagcggtggcacttcttccgcaacttc
ctctccaacgtcgagatgaccctcgccaagaccgacctgcgcatcgcccgccactacgtg
gacaccctcgtccccgacgagctcaagcacgtcttcgaccgcatccaggccgaacacgag
ctcaccgtccgcgaggtcctgcgcatcaccggcggccggcagctgctcgactccaacccg
gtcctccagcagaccttcgccgtccgcgacgcctacctcgaccccatctcctacctccag
gtctccctgctggcccgccagcgcgccgccgccgaacgcggcgaggaggccgacccgctg
ctcgcccgggcgctcctgctcaccgtcaacggagtcgccgccggcctgcgcaacaccggc
tga

DBGET integrated database retrieval system