KEGG   Streptomyces sp. Mg1: M444_23165Help
Entry
M444_23165        CDS       T03958                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
strm  Streptomyces sp. Mg1
Brite
KEGG Orthology (KO) [BR:strm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M444_23165
Enzymes [BR:strm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M444_23165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AKL67835
UniProt: B4V999
LinkDB All DBs
Position
1:5289725..5290120
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKAKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRARAITIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPQLHTLVNDTLKALSAAKASNDPATGQKALELIAE
IDRIFWETKAA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctcttcgcccccaaggcgaaggtctccgcccactgtgacctgccgtgc
ggcgtgtacgaccctgcccaggcccgcatcgaggccgagtccgtcaaggccgtccaggag
aagtaccaggccaacgaggacgccgacttccgcgcgcgcgccatcaccatcaaggagcag
cgggccgagctcgccaagcaccacgtctcggtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccgcagctgcacacgctggtcaacgacaccctgaaggccctctcg
gccgcgaaggcgtcgaacgacccggcgacgggccagaaggcccttgagctcatcgccgag
atcgaccggatcttctgggagaccaaggccgcctga

DBGET integrated database retrieval system