KEGG   Streptomyces sp. Mg1: M444_26455Help
Entry
M444_26455        CDS       T03958                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
strm  Streptomyces sp. Mg1
Brite
KEGG Orthology (KO) [BR:strm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    M444_26455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C YrzO
Motif
Other DBs
NCBI-ProteinID: AKL68383
UniProt: A0A0G3URC0
LinkDB All DBs
Position
1:6086429..6087913
Genome map
AA seq 494 aa AA seqDB search
MNSPFRTKTVEQSIRDTEEPEHALRKSLSAWDLTVFGVGVIIGTGIFVLTGIAARNNAGP
ATSLAFVAAGIVCALAALCYAEFASTVPVAGSAYTFAYASIGELPAWIIGWDLVLEFALG
TAVVAVGWSGYVRHLMHTNLGWDLPTTLAGPDAGGSFDLLAFLLVLVLTVILVVGTKLSA
RITAVVVAIKVTVVLLVIIAGLFFIKGDNYSPFIPPAQPQTTGGGWTAPLVQLMFGYEPT
NFGVMGIFTAASLVFFAFIGFDVVATAAEETKNPQRDMPRGILGSLIICTVLYVAVTLVV
TGMQKYSEMSATAPLAEAFKSVNQPFFAGAISLGASVGLITVCMILLLGQTRVFFAMSRD
GLLPRVFSVTHPKYRTPYRATVLLGGIIAVVAGFTSLEKLAELVNIGTLFAFVVVALGVM
VLRKTRPDLHRSFRTPWVPVVPILSIAASLWLMLNLPAETWLRFGIWMLIGFVVYFLYGR
RNSRLAKAGADAEY
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtcccttccgcaccaagacggtggagcagtccatccgggacacggaggagccg
gaacacgccctccggaagtcgctctccgcctgggacctgacggtcttcggcgtcggtgtg
atcatcggtacgggcatcttcgtcctcacgggcatcgcggcgcggaacaacgccggaccc
gccacctccctggccttcgtggcggcgggcatcgtctgcgccctcgcggcgctctgctac
gccgagttcgcgtccaccgtcccggtggcgggctcggcctacaccttcgcgtacgcctcg
atcggcgagctgcccgcctggatcatcggctgggacctggtgctcgaattcgcgctcggc
accgccgtcgtcgcggtcggctggtccgggtacgtccgccacctcatgcacaccaacctg
ggctgggacctgcccaccacactggccgggcccgatgcgggaggcagcttcgacctgctg
gccttcctgctggtcctggtgctgacggtgatcctggtcgtggggacgaagctctcggcc
cggatcacggcggtcgtggtcgccatcaaggtcaccgtggtgctgctggtcatcatcgcc
ggcctgttcttcatcaagggcgacaactactccccgttcatcccgccggcccaaccgcag
accaccgggggcggctggacggcgcccctggtccagctgatgttcgggtacgagcccacc
aacttcggcgtcatgggcatcttcaccgcggcctccctcgtcttcttcgccttcatcggc
ttcgacgtggtggccaccgcggccgaggagaccaagaacccccagcgggacatgccgcgc
ggcatcctcggctcgctgatcatctgcaccgtgctgtacgtcgccgtgacgctggtggtc
accggcatgcagaagtactcggagatgtcggccaccgcgccgctcgccgaggccttcaaa
tccgtgaaccagccgttcttcgccggtgccatcagcctcggggcgtccgtcggcctgatc
accgtgtgcatgatcctgctgctcggccagacccgcgtgttcttcgcgatgagccgtgac
ggactgctgccgcgcgtcttctccgtcacgcaccccaagtaccgcacgccctaccgggcc
accgtactgctcggcgggatcatcgccgtcgtcgcgggcttcaccagcctggagaagctc
gcggaactggtgaacatcggcaccctgttcgccttcgtggtggtcgccctcggcgtgatg
gtcctgcgcaagacccgccccgacctgcaccggtccttccgcaccccgtgggtgccggtg
gtcccgatcctgtcgatcgcggcctcgctctggctgatgctcaacctgccggccgagacc
tggctccggttcggcatctggatgctcatcggcttcgtcgtctacttcctgtacggacgc
cgcaacagccgcctcgccaaggccggcgcggacgccgaatactag

DBGET integrated database retrieval system