KEGG   Streptomyces sp. Mg1: M444_27450Help
Entry
M444_27450        CDS       T03958                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00250  Alanine, aspartate and glutamate metabolism
strm00410  beta-Alanine metabolism
strm00640  Propanoate metabolism
strm00650  Butanoate metabolism
strm01100  Metabolic pathways
strm01120  Microbial metabolism in diverse environments
Module
strm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    M444_27450
   00650 Butanoate metabolism
    M444_27450
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M444_27450
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M444_27450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strm01007]
    M444_27450
Enzymes [BR:strm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     M444_27450
Amino acid related enzymes [BR:strm01007]
 Aminotransferase (transaminase)
  Class III
   M444_27450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AKL70336
UniProt: A0A0G3UXD3
LinkDB All DBs
Position
1:6326484..6327737
Genome map
AA seq 417 aa AA seqDB search
MPDWLALYYDRPLELTHGEGRHVWDAEGNRYLDFFGGILTTMTAHALPEVTKAVAEQAGR
LIHSSTLYLNRPMIELAERVAALSGIPDARVFFTTSGTEANDTALLLATTYRRSNQILAM
RNSYHGRSFSTVSITGNRGWSPTSLSPLQTYYVHGAVRSRGPFAELGDAAFTAAAVADLE
DVLGQARGGVAALIAEPIQGVGGFTSPPDGLYGAFREVLDRHGILWISDEVQTGWGRTGE
HFWGWQAHAQNGPPDILTFAKGIGNGMSIGGVVARAEVMNCVDSNSISTFGGSPVTMAAG
VANLGYLLEHDLQGNARRVGGLLLERLRAIAATVPAVREVRGRGLMAGLELTRPGTDQAD
PDAAAAVLEAARAGGLLLGKGGGYNTSVLRIAPPLSLTVAEAEEGAEILAEALHSLT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcccgactggctcgcgctgtactacgaccgcccgctcgaactcacccacggcgagggc
cgccacgtctgggacgccgagggcaaccgctacctcgacttcttcggcggcatcctcacc
acgatgaccgcccacgccctccccgaggtcaccaaggccgtcgccgagcaggccgggcgg
ctcatccactcctccaccctgtacctcaaccgcccgatgatcgaactggccgagcgggtc
gccgccctctccggcatccccgacgcccgggtcttcttcaccacctccggcaccgaggcc
aacgacaccgccctgctgctcgcgacgacgtaccgccgctccaaccagatcctggcgatg
cgcaacagctaccacggccggtccttctccaccgtctcgatcaccggaaaccgcggctgg
tccccgacgagcctctcgccgctccagacctactacgtccacggcgccgtccgcagccgc
ggccccttcgcggaactcggtgacgccgcgttcaccgcggccgccgtcgccgacctcgaa
gacgtactgggccaggcccgcggcggcgtcgccgccctcatcgccgagccgattcagggc
gtcggcggcttcacctccccgcccgacggactctacggggcgttccgcgaggtcctggac
cgccacggcatcctctggatcagcgacgaggtgcagaccggctggggccgtaccggagaa
cacttctggggctggcaggcccacgcccagaacggcccgccggacatcctcaccttcgcc
aagggcatcggcaacggcatgtccatcggcggtgtcgtggcccgcgccgaggtgatgaac
tgcgtcgactccaactccatctccaccttcggcggctccccggtcacgatggccgcaggc
gtcgccaacctcgggtacctgctggagcacgacctccagggcaacgcccgccgcgtcggc
ggcctcctcctggaacggctgcgcgccatcgccgccaccgtgcccgccgtacgggaggtc
cgcggccggggcctgatggccgggctggagctgacccggcccggcaccgaccaggccgac
ccggacgcggccgccgccgtcctggaggccgcccgcgccggcggcctcctgctcggcaag
ggcggcgggtacaacaccagcgtgctgcgcatcgcgccgccgctctccctcaccgtcgcc
gaggcggaagagggcgccgagatcctcgccgaggccctgcacagcctcacctag

DBGET integrated database retrieval system