KEGG   Streptomyces sp. Mg1: M444_29855
Entry
M444_29855        CDS       T03958                                 

Definition
(GenBank) dTDP-4-dehydro-6-deoxyglucose aminotransferase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00523  Polyketide sugar unit biosynthesis
strm01100  Metabolic pathways
strm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    M444_29855
Enzymes [BR:strm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     M444_29855
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase NIT Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AKL68937
UniProt: B4VAH9
LinkDB
Position
1:complement(6879020..6880231)
AA seq 403 aa
MKRNVGDLAVFGGPSAFLQPLHVGRPNVGDRARFFDRVNWALDHQWLTNGGPLAREFEQR
VAELAGVRYCVSTCNATVALQLLARAADLSGEVIMPSLTFPATAQAFRWLGLTPVFCDID
PATSCLDPALVEAAITPRTSAIVPVHLWGRPCAVDQLAKVAADHGIKLFYDAAHGLGCTA
EGQPIGGFGQAEVFSFHATKVVNAFEGGAVVTDDEELARRVRAMHNFGFAQGRVSTEAGT
NGKMTEAAAAMGLTSLDAFEETVRRNEANYDDYRSELAGIAGLKVMEFNRAERNNYHYLI
VEVDAAVTGVHRDLLDWVLRAENVVCQRYFSPGCHEMELYRSERPVTLPHTERLAQRVLA
LPTGPTVSREDIRRVCDIVRVTLERGHEVTRRADERVPSTLAP
NT seq 1212 nt   +upstreamnt  +downstreamnt
ttgaaacgcaatgtcggtgatctcgctgtattcggcggtccttcggcattcctgcaaccg
cttcacgtggggcggcccaacgtcggtgaccgagcccggttcttcgatcgcgtgaactgg
gcgctggaccaccagtggctcaccaacggcggaccgctggcgcgggagttcgagcagcgg
gtggcggagctggccggcgtgcgctattgcgtgtcgacctgcaacgcgaccgtcgccctc
cagctgctggcccgcgccgcggatctgtccggggaggtcatcatgccgtcactgacgttc
ccggcgaccgcccaggcattccgctggctgggtctgaccccggtcttctgtgacatcgac
ccggccaccagttgcctggaccccgcactggtcgaggcggcgataacccctcgcaccagt
gcaatcgttcccgtccatctgtggggtcgtccgtgcgcggtcgaccagctcgcgaaggtc
gcggccgatcacggcatcaagctgttctacgatgccgcgcacgggctcggctgcacggcg
gaagggcagccgatcggtggcttcgggcaagccgaggtgttcagttttcacgccaccaag
gtggtgaacgccttcgagggcggcgcggtggtgaccgacgacgaggaactggcccgacgg
gtccgcgcgatgcacaacttcgggttcgcccagggacgcgtgtccacggaggcgggcacc
aacgggaagatgaccgaagccgccgccgcgatgggcctgacctcgctcgacgccttcgag
gagacggttcgccggaacgaggccaactacgacgactaccggtctgaactcgctggtatc
gccgggctgaaggtcatggaattcaaccgtgccgagcgcaacaactaccactatctgatc
gtggaggtggacgccgcggtgaccggtgtccaccgtgacctgctggactgggtgctcaga
gcggagaacgtggtgtgccagcggtacttctcccccggatgccatgagatggagctctac
cgctcggagcggccggtcaccctgccgcacaccgaacggctcgcgcagagggtactcgcc
ctgcccaccggtcccaccgtctcccgtgaggacatccggcgggtctgcgacatcgtccgg
gtcaccctggagcggggacacgaggtgacccgcagagccgacgagcgggtgccctccacg
ctggccccctga

DBGET integrated database retrieval system