KEGG   Streptomyces sp. Mg1: M444_30780Help
Entry
M444_30780        CDS       T03958                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00250  Alanine, aspartate and glutamate metabolism
strm00410  beta-Alanine metabolism
strm00430  Taurine and hypotaurine metabolism
strm00650  Butanoate metabolism
strm01100  Metabolic pathways
strm01110  Biosynthesis of secondary metabolites
strm01120  Microbial metabolism in diverse environments
strm02024  Quorum sensing
Module
strm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M444_30780
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M444_30780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M444_30780
   00430 Taurine and hypotaurine metabolism
    M444_30780
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    M444_30780
Enzymes [BR:strm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     M444_30780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AKL69083
UniProt: A0A0G3UTC5
LinkDB All DBs
Position
1:7116527..7117918
Genome map
AA seq 463 aa AA seqDB search
MALHETKDVPAQDADTDVFTSALSGEILPKYRMPEDHSPSEVVYELLHNELLLDGNAAQN
LATFCTTWSDDGVRRLMAECLDKNMIDKDEYPQTAEIESRCVNILADLWNAPSGGAATGC
STTGSSEAAMLGGLALKWRWRERRRAAGLPVDRPNLICGPVQICWDKFARYFDVELRQIP
LEPGATGLRPHQLAQYVDENTIGVVAILGVTYSCDYEPVAEICAELDRIQAEHGWDVPVH
VDAASGGFVAPFLHPDVVWDFRLPRVASVNTSGHKYGLAPLGVGWIVWRTADLLPADLVF
NVDYLGGDMPTFALNFSRPGGEVIAQYYLFLRLGRGGYRRVQLACAETAQYLAQEIAAMG
PFTLLYDGRGGLPAVSYTLADPEGSPFTLYDLSDRLRMRGWQVPSYALPADRDDTVIQRV
LIRHGVTRDQIALLASDLRKAVEHLTATPPPVPATEPRSGFHH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcatgagacgaaggacgtacccgcccaggacgccgacacggacgtgttcact
tccgcgttgagtggcgagatcctccccaagtaccggatgccggaggaccactcgccctcc
gaggtggtctacgagctcctgcacaacgagctcctcctcgacggcaacgcggcccagaac
ctggccaccttctgcaccacctggtccgacgacggcgtgcgccgcctgatggccgagtgc
ctcgacaagaacatgatcgacaaggacgagtacccgcagacggccgagatcgaatcccgc
tgcgtcaacatcctggccgacctctggaacgccccctccggcggcgcggccaccggctgc
tccaccaccggctccagcgaggcggccatgctcggcggcctcgccctcaaatggcgctgg
cgcgaacgccgccgcgccgccggcctccccgtcgaccgtcccaacctcatctgcggcccg
gtacagatctgctgggacaagttcgcccgctacttcgacgtcgagctgcgccagatcccg
ctggagcccggcgccaccggcctgcggccccaccagctcgcccagtacgtggacgagaac
accatcggcgtcgtcgccatcctcggcgtcacctacagctgcgactacgaacccgtcgcc
gagatctgcgccgaactcgaccggatccaggccgaacacggctgggacgtgcccgtccac
gtcgacgccgccagcggcgggttcgtcgcccccttcctccaccccgacgtcgtctgggac
ttccggctgccgcgcgtggcctccgtcaacacctcgggccacaagtacggcctggccccc
ctcggcgtcggctggatcgtctggcgcaccgccgacctcctccccgccgacctcgtcttc
aacgtggactacctcggcggcgacatgccgaccttcgccctcaacttctcccgcccaggc
ggcgaggtcatcgcccagtactacctgttcctgcgcctgggccgcggcggctaccggcgc
gtccagctggcctgcgccgagacagcccagtacctggcccaggagatcgccgcgatgggc
cccttcaccctcctctacgacggccggggcggcctccccgccgtctcgtacaccctcgcc
gacccggaggggagccccttcacgctctacgacctctccgaccggctgcggatgcgcggc
tggcaggtgccctcgtacgcgctgccggccgaccgcgacgacaccgtcatccaacgcgtc
ctgatccggcacggcgtgacccgcgatcagatcgccctgctcgcctctgacctgcgcaag
gccgtggaacacctcaccgccacaccgccgcccgtgcccgccaccgagccccggtccggc
ttccaccactga

DBGET integrated database retrieval system