KEGG   Streptomyces sp. Mg1: M444_37940
Entry
M444_37940        CDS       T03958                                 

Definition
(GenBank) methyltransferase
  KO
K21178  O-methyltransferase [EC:2.1.1.-]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm01059  Biosynthesis of enediyne antibiotics
strm01100  Metabolic pathways
strm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    M444_37940
Enzymes [BR:strm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     M444_37940
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_25 MTS Methyltransf_24 Methyltransf_31 Dimerisation Rrf2
Other DBs
NCBI-ProteinID: AKL71156
UniProt: A0A0G3UZR5
LinkDB
Position
pSMg1-3:complement(98109..99083)
AA seq 324 aa
MAHLATPMALRVAATLRVADHIAAGVRTAPEIAREAKADPDALARLLRYLAARGVLRRDA
AGGYELTALGEPLRDDHPDGMRAKLDIEGTVGRAELCFVHLLHTIRTGEAAYPLQYGLQF
WDDLDQHPERGASFDTWMSSSAPDRAQAIIAGYAWGDLGDLVDVGGGNGSLLVALLRAFP
QLNGTLVDMSEPAATAQRALEAAGLTDRGRAVVGSFFDPLPKGAKGYLLSLIIHDWGDAE
AVEILARCAEAAGADGSVFVVENLGADGETPPAGMDLRMLAFSGGKERGLAELAGLAERA
GLRIVARHGAGTLSIVEMAAATLA
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcgcatctggccactcccatggcgctgcgtgtggcggccactttgagggtcgccgac
cacatcgcggccggagtgcgcaccgctcccgagatcgcccgcgaggcgaaggccgatccg
gacgcgctggcgcgactgctgcgctacctcgccgcacggggtgtgctgcgccgcgacgcc
gcgggcggctacgagctgaccgcgctcggcgaacccctgcgcgacgaccaccccgacggg
atgcgggccaagctcgacatcgagggcacggtcgggcgggccgaactctgcttcgtccac
ctgctgcacaccatccgcaccggcgaggccgcctaccccctccagtacgggctgcagttc
tgggacgacctcgaccagcaccccgagcgcggggcctcgttcgacacctggatgagctcc
agcgcccccgaccgcgcccaggcgatcatcgccggctacgcctggggcgacctgggcgac
ctggtcgacgtcggtggcggcaacggttcgctgctggtggcgctgctgcgggccttcccg
cagctgaacggcaccctcgtggacatgtcggaacccgcggccaccgcccagagggcgctg
gaggcggcgggcctgaccgaccgcggccgggccgtcgtgggcagcttcttcgatcccctg
cccaagggcgccaagggctacctgctctcgctgatcatccacgactggggtgacgcggag
gccgtggagatcctggcgcgctgcgcggaagcggccggcgcggacggctccgtcttcgtg
gtggagaacctgggcgccgacggtgagaccccgccggccggcatggacctgaggatgctc
gccttctccgggggcaaggagcggggcctggcagaactcgccgggctcgcagagcgggcc
ggtctgcgcatcgtggcccgccacggcgcgggcaccctgtcgatcgtcgaaatggccgcc
gcgaccctcgcctga

DBGET integrated database retrieval system