KEGG   Streptococcus sp. NPS 308: SNAG_0303Help
Entry
SNAG_0303         CDS       T05541                                 

Gene name
alaA
Definition
(GenBank) glutamate-pyruvate aminotransferase AlaA
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
strn  Streptococcus sp. NPS 308
Pathway
strn00220  Arginine biosynthesis
strn00250  Alanine, aspartate and glutamate metabolism
strn00290  Valine, leucine and isoleucine biosynthesis
strn01100  Metabolic pathways
strn01110  Biosynthesis of secondary metabolites
strn01130  Biosynthesis of antibiotics
strn01210  2-Oxocarboxylic acid metabolism
strn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:strn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SNAG_0303 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    SNAG_0303 (alaA)
   00220 Arginine biosynthesis
    SNAG_0303 (alaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strn01007]
    SNAG_0303 (alaA)
Enzymes [BR:strn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SNAG_0303 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     SNAG_0303 (alaA)
Amino acid related enzymes [BR:strn01007]
 Aminotransferase (transaminase)
  Class I
   SNAG_0303 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: BAV79206
UniProt: A0A1E1G8V9
LinkDB All DBs
Position
264260..265474
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVGIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEEAEWYPDLDDIKSKISSNTKAIVLINPNNP
TGALYPKELLLDIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDHNMYRIDDDEQFVLNFLKQEK
VLLVHGRGFNWKEPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaacaagtctagtaagttagagcatgtggcttatgatattcgtggtccg
gttttggaagaagccatgcggatgcgcgcaaatggtgaaaagattttgcgtctaaataca
gggaatcctgctgaatttggttttacagcacctgatgaagtcattcatgatttgattatg
aatgcgcgtgatagtgaaggttactctgattccaagggtattttttcggcgcgtaaggct
attatgcagtattgccaactgaaaaaatttccaaacgtaggcatcgacgacatctaccta
ggtaacggtgtcagtgagctgattgttatgtccatgcaagggcttttggacaatggtgat
gaggtcttggtacctatgccagactatcctctctggacggctgctgtcagcttggctgga
ggaaatgctgttcactatatctgtgatgaagaagcagaatggtaccctgatctggacgat
attaaatctaagattagctctaataccaaggctattgtccttatcaatccaaataaccca
acgggagctctctatcctaaagaactcttgttggatattattgagattgctcgtcaaaac
gatttgatcatctttgcggacgaaatctacgaccgcatggtaatggatggacatgtgcat
acgcctgtggcgagcttggcaccagatgtcttctgtgtcagcatgaatggtctatcaaaa
tctcaccgtatcgctggttttcgtgtaggatggatggtcttgtctggtcctaagcaccat
gtcaagggctatatcgaagggctcaatatgctgtccaatatgcgtctttgctctaacgtt
ttggcccagcaagtcgtacaaacatcactaggtgggcaccagtcagtggatgaattgctc
cttcctggtggacggatttacgagcaaagaaacttcatttacaatgctatccaagatatc
ccaggtttgtctgcggtcaagcctaaggcgggtctttatatcttccctaaaattgaccat
aatatgtaccgcatcgatgatgatgagcagtttgttctcaatttcttgaaacaagaaaag
gttcttttggttcatggtcgtggttttaactggaaggaaccagaccatttccgtatcgtt
taccttcctcgtgtggatgaattggcacaaatccaagaaaagatgactcgtttcttgaaa
cagtatcgtagatag

DBGET integrated database retrieval system