KEGG   Streptococcus sp. NPS 308: SNAG_0707Help
Entry
SNAG_0707         CDS       T05541                                 

Gene name
amyS
Definition
(GenBank) alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
strn  Streptococcus sp. NPS 308
Pathway
strn00500  Starch and sucrose metabolism
strn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNAG_0707 (amyS)
Enzymes [BR:strn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SNAG_0707 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: BAV79585
UniProt: A0A1E1G9W5
LinkDB All DBs
Position
complement(673917..675365)
Genome map
AA seq 482 aa AA seqDB search
MQNQTLMQYFEWYLPHDGQHWARLTNDAEHLANLGISHVWMPPAFKATNEKDVGYGVYDL
FDLGEFHQKGTVRTKYGFKEDYLQTIQTLKEHGIQPMADIVLNHKAAADKLEAFQVIEVD
PEDRTVQLSEPFTINGWTHFTFDGRQKTYNDFEWHWYHFTGTDYDAKRRKSGIYLIQGDN
KGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHID
SFFMGNFIRDMKEKYGEDFYVFGEFWNPDKEANLDYLERIEERFDLVDVHLHQNFFEASQ
AGASYDLRTIFTDSLVEVKADKAVTFVDNHDTQRGQALESTVQEWFKPAAYALILLREQG
LPCVFYGDYYGISGQYAQEDFREVLDRLLAIRKDLAYGEQTDYFDDANCIGWVRAGAENQ
TPLAVLISNDQENSKSMFVGQEWAGQTFVDLLENHPAQVTINAEGYGEFPVAAGSVSVWA
TK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaaacacttatgcaatactttgaatggtatctgcctcatgacggccagcac
tgggctcgactaacaaatgacgcagagcacctagcaaaccttggtatcagccatgtctgg
atgccacctgccttcaaggcaaccaacgaaaaagatgtaggctatggtgtttatgatctt
tttgacctaggcgaatttcatcaaaaagggactgttcgtactaaatatggatttaaggaa
gattatctccaaacgattcagactctcaaggagcacggaatccaaccaatggctgacatc
gttcttaatcacaaggcagcagcagataaactagaagcctttcaggttatcgaagtcgat
ccagaagaccgtacagttcaactaagtgagccctttactatcaacggatggacccacttt
acttttgatggacgtcagaaaacctataatgactttgaatggcactggtaccatttcaca
ggtacagactatgatgccaagcgccgtaagtctggcatttacctgatccaaggagacaat
aaaggttgggcaaacgaggaattggtcgataacgaaaacggcaactacgactatctcatg
tacgctgacctggactttaagcaccctgaagtcatccaaaacatctatgactgggctgac
tggttcatggaaacgactggagttgctggtttccgcttggatgctgttaaacacattgac
tccttctttatgggtaattttatccgtgatatgaaggaaaaatacggtgaagatttctat
gtttttggtgaattttggaatccagacaaagaagccaatctggactatcttgaaagaatt
gaggagcgctttgaccttgtcgatgtgcatctccaccaaaatttctttgaagccagtcag
gctggagcaagctacgaccttcgtactatctttactgatagcttggttgaagtcaaggct
gacaaggctgtcactttcgttgacaaccatgatactcaacgaggacaggcacttgaatca
accgtccaagaatggttcaagccagcagcctatgcgctcattcttcttcgtgagcaaggc
cttccatgtgtcttttatggagactactatggaatttctgggcagtatgcccaagaagat
ttcagagaagttcttgaccgtctcctagccatccgaaaagacttggcctatggagagcaa
acagactactttgacgatgccaactgcatcgggtgggttcgtgcaggtgctgaaaaccaa
acaccgctcgcggtccttatctcaaacgaccaagaaaatagcaagtctatgtttgttggt
caagaatgggctggccaaacctttgttgatcttcttgaaaatcatccagcacaagttacg
atcaatgctgaaggttatggagaattcccagtagcggcgggttcagtcagtgtctgggca
acaaaataa

DBGET integrated database retrieval system