KEGG   Streptococcus sp. NPS 308: SNAG_0806Help
Entry
SNAG_0806         CDS       T05541                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
strn  Streptococcus sp. NPS 308
Brite
Enzymes [BR:strn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SNAG_0806 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAV79684
UniProt: A0A1E1GAB0
LinkDB All DBs
Position
774375..774980
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattatcttaccagatcttccatacgcttacgatgcattggaaccatatattgat
gctgaaacaatgcacttgcaccatgacaagcaccatcaaacttatgtcaacaatgccaat
gctgctcttgaaaaacaccctgaaatcggtgaagaccttgaagctttgcttgctgatgta
gaatctatcccagctgatatccgccaagcacttatcaacaatggtggtggacacttgaac
cacgctcttttctgggaattgatgactcctgagaaaactgctccatcagcagaacttgca
gcagcaattgatgcaacatttggttcatttgaagagttccaagcagcctttacagcagca
gctacaactcgatttggttctggctgggcatggttggttgtcaacaaagaagggaagctt
gaagtgacttcaacagcaaaccaagacaccccaatctcagaaggcaaaaaaccaatcttg
ggcttggatgtttgggaacatgcttactacgtgaaataccgcaacgtgcgtcctgactac
atcaaagctttcttctcagtgattaactggaacaaagtagacgagctttacgcagcagct
aaataa

DBGET integrated database retrieval system