KEGG   Streptococcus sp. NPS 308: SNAG_1165Help
Entry
SNAG_1165         CDS       T05541                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
strn  Streptococcus sp. NPS 308
Pathway
strn00620  Pyruvate metabolism
strn00680  Methane metabolism
strn01100  Metabolic pathways
strn01120  Microbial metabolism in diverse environments
strn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:strn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SNAG_1165 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SNAG_1165 (ppc)
Enzymes [BR:strn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SNAG_1165 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 PKHD_C
Motif
Other DBs
NCBI-ProteinID: BAV80039
UniProt: A0A1E1GB89
LinkDB All DBs
Position
complement(1142132..1144828)
Genome map
AA seq 898 aa AA seqDB search
MSLQKLENYSNKAVVQEEVLILTELLEDITKNMLAPETFEKIIQLKELSTSENYQGLNDL
VTSLSNEEMIYISRYFSILPLLINISEDVDLAYEINHQNNVDQDYLGKLSTTIKMVAEKE
NAATILEQLNVVPVLTAHPTQVQRKSMLDLTNHIHNLLRKYRDVKLGLINKEKWHTDLRR
YIEIIMQTDMIREKKLKVTNEITNVMEYYQSSFLNAVPRLTAEYKKLAKEQGIELEHPKP
ITMGMWIGGDRDGNPFVTAETLNKSALTQCEVIMNYYDEKIYNLYREFSLSTSIVNVSDK
VREMALKSQDNSIYREKELYRRALFDIQAKMQATKAYLIEDKELQPRYATADEFYQDLLA
IRDSLLENKGEYLISGEFVELMQAVEIFGFYLASIDMRQDSSVHEACVAELLESAGINDH
YSDLSEDEKCALLLKELEEDPRILSATHAEKSELLEKELSIFKAARKLKDKLGENVIRQT
IISHATSVSDMLELAIMLKEVGLVDAQKARVQIVPLFETIEDLDHSEETMRRYFSLPLAK
KWIASKDNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKVTFFHGRGGTV
GRGGGPTYEAITSQPLKSIKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMITK
KKSDTNTSNRYEAIMDQVVDRSYDIYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFIDQDPKNIEFLRDMYQNWPFF
QSLLSNVDMVLSKSNMNIAFEYAKLCEDEEVQAIYYTILDEWQLTKDVILAIEGYDELLA
ENSYLKDSLNYRMPYFNILNYIQLELIKRQRRGELSADEERLIHTTINGIATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcaaaaattagaaaactatagtaataaagcagtcgtccaagaagaagtcttg
attctgactgagctattagaagatatcacaaaaaatatgctagcgccagaaacctttgaa
aagattatccagttgaaggaattatcaactagcgagaattatcaagggctcaatgaccta
gtgaccagtctttcgaatgaagaaatgatttacatttcacgctatttctcaatccttcca
ctcttgatcaatatctctgaggatgtggatttggcttatgagatcaatcaccaaaacaat
gtggaccaagactatctagggaaactatctacaaccattaaaatggtggctgaaaaagaa
aatgcagctacaattttggaacagctgaatgttgtgcctgttctgactgcccatccgacg
caggtccaacgtaagagtatgttggatttgaccaatcacatccataatcttttgcgtaag
taccgtgatgtcaaactaggcttgattaacaaagaaaaatggcacacggatctccgtcgt
tatattgagattattatgcagacggacatgattcgcgagaagaaattgaaagtaaccaac
gaaatcaccaacgtgatggagtactatcaaagttcattcttgaatgctgttccccgtttg
acggctgagtataaaaaattggccaaagaacaaggtatcgagcttgagcatccaaaaccg
attaccatggggatgtggatcggaggagaccgtgatggaaatcctttcgtaactgctgaa
accctcaataaatctgccttgacccagtgtgaagtcattatgaattactacgatgagaag
atttataacctctatcgtgaattctcactctcaaccagtattgtgaatgtcagcgacaag
gttcgtgagatggctcttaagtcacaggataactcgatttatcgcgaaaaagaactctat
cgtcgtgctctttttgatatccaagctaagatgcaggcaaccaaggcttatctcattgaa
gacaaggaacttcagcctagatatgccactgcagatgaattttatcaagatttgttggcc
attcgcgattctctccttgaaaacaaaggggaatacctgatttcaggagaatttgtcgag
ttgatgcaagctgtcgaaatttttggtttctaccttgcttctattgatatgcgccaagat
tctagtgttcatgaagcctgtgtagcagaattgcttgaatctgctggtatcaatgatcac
tatagcgacctttctgaagacgaaaaatgcgcccttctcttaaaagagttggaagaagac
cctcgtatcctctcagccactcatgctgaaaagtcagaacttcttgaaaaggaactgtct
atctttaaagctgcccgcaagttgaaggataaactgggtgaaaatgtcattcgtcaaacc
attatctcacatgcaacaagtgtatccgatatgctagagctagcaattatgctcaaggaa
gtcggcttggttgatgcccaaaaagcacgagttcagattgttcccctgtttgaaactatc
gaggacttagaccattcggaagaaaccatgagaagatatttctctcttcctttggctaaa
aaatggattgcttcaaaagataactatcaggaaatcatgcttggttactctgatagtaac
aaagatggtggttacctgtcatcgtgttggaccctgtacaaggcgcaacaacaactgact
gctatcggtgatgaatttggcgttaaagtcactttctttcacggtcgtggtgggactgtc
ggtcgtggtggtggtccaacatatgaagccattacatctcaaccgctcaagtctataaag
gaccgtatccgtctgactgagcaaggagaagtgattggaaacaaatacggtaacaaagac
gctgcttattacaaccttgagatgttggtttctgcagccattaaccgtatgattaccaag
aagaagagtgataccaacacatcaaaccgttacgaagctattatggatcaagtagtggat
cgcagctacgatatctaccgtgatttggtctttggaaatgaacatttctatgactatttc
tttgagtccagtccgattaaggctatttcaagctttaatatcggttctcgcccagccgct
cgtaagaccatcactgaaattggcggtttgcgtgccattccttgggtcttctcatggtca
caaagtcgtgtcatgttccctggatggtatggtgtgggatcaagctttaaagagtttata
gatcaagatccaaagaatatcgagttccttcgtgatatgtaccagaactggcctttcttc
caatctcttctttccaatgtggacatggtcttatctaagtctaacatgaacattgctttt
gaatatgctaagctctgtgaagacgaagaagtgcaagctatctactacactattttagat
gaatggcaattgaccaaggatgttattttagctattgaaggttatgacgaactcttggca
gaaaactcttacctaaaagacagtctaaactatcgtatgccttactttaatatcctcaac
tatatccagttggagttgattaaacgtcaacgtcgtggtgaattgtcagcagacgaagaa
agattgattcatacaaccattaacggaattgcaaccggtttgcgtaattcaggttga

DBGET integrated database retrieval system