KEGG   Streptococcus sp. NPS 308: SNAG_1505Help
Entry
SNAG_1505         CDS       T05541                                 

Gene name
stkP
Definition
(GenBank) serine/threonine-protein kinase StkP
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
strn  Streptococcus sp. NPS 308
Brite
KEGG Orthology (KO) [BR:strn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:strn01001]
    SNAG_1505 (stkP)
Enzymes [BR:strn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SNAG_1505 (stkP)
Protein kinases [BR:strn01001]
 Serine/threonine kinases: Other
  Bacterial family
   SNAG_1505 (stkP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: BAV80374
UniProt: A0A1E1GCA0
LinkDB All DBs
Position
complement(1481718..1483619)
Genome map
AA seq 633 aa AA seqDB search
MIQIGKIFAGRYRIVKQIGRGGMADVYLAKDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EARAMADLDHPHIVRITDIGEEDGQQYLAMEYVAGLDLKRYIKEHYPLSNEEAVRIMGQI
LLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATFQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVP
QALENVVIKATAKKLTDRYQSVSEMYVDLSSSLSYNRRNEPKLVFDDASKADTKTLPKVP
QSTLTSIPKAPAQEERPQPKKATQPVAEPAPAPKPAKKRKFKARYMILLASLLLVVASLI
WILSRTPATIAIPDVAGQTVAEAKEALKKSKFEAGEEKSEASDTVAEGRVIRTDPEAGSG
RKEGTKVNLVVSSGKQSFQLSNYVGRKYTEVVAELKEKKVPENLIQMEEEESSESEPGTI
LRQTPASGSTYDLSKATTITLTVAKKVTSVSMPNYIGSSLEFTKNNLTQIVGVKEANIEV
IEVSTAPEGTAEGTVVSQTPKAGEKVDLASTRIKLSIYKPKTPPSTSSSNPAQRGNQGST
TTPNQGNQQGNQQGNNPPTNQPNNEGNRESSRD
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaatcggcaagatttttgccgggcggtatcggattgtcaagcagattggtcga
ggaggcatggcagatgtttacttggccaaggatttgatcctagacggggaagaagtggca
gtgaaggtcctgaggaccaactaccagacagaccctattgctgtggcacgtttccaacgt
gaagcgagagccatggcggatctggaccatcctcatatcgttcggataacagatattggt
gaggaagatggtcaacagtacctagctatggaatacgtagcaggtcttgacctcaagcgt
tatatcaaagaacactatcctctttcaaacgaagaagcagttcggattatgggacaaatc
ctcttagcaatgcgcttagcccatactcgaggaatcgttcaccgggatttgaaacctcaa
aatatcctactgacccctgatggcacagccaaggtcacggactttggaattgcagtagcc
tttgcggagaccagtctgactcagacaaactcgatgctaggctccgttcattacttgtca
cctgagcaagcgcgtggttctaaagcgactttccagagcgatatctatgcaatggggatt
atcttctatgagatgctaactggtcacattccttacgatggggatagtgcagttacgatt
gctctccagcatttccagaagcctcttccatcagtcattgctgaaaacccatctgtccct
caggctttagaaaatgttgtcatcaaggcaactgccaagaaattgacggatcgctatcag
tctgtttcggaaatgtatgtagatttgtcgagtagtttgtcctacaatcgccgaaatgaa
ccaaaattggtctttgatgatgccagcaaggcagataccaagaccttgcctaaagttcca
caaagtacactgacgtctattcctaaagcgcctgcgcaggaagagcgtcctcagccaaag
aaagctactcaaccagtcgctgagccagcacctgcaccaaagccagctaaaaaacggaag
tttaaagctcgctatatgattcttttagctagccttctattggttgtagcctctttaatc
tggattttgtcaagaacacctgcaacgattgctattcctgacgtggctggacaaactgtt
gcagaagccaaagaagcactcaaaaaatccaagtttgaagctggcgaagagaaatcggag
gctagtgatacagtagcagaaggacgcgttattcgaaccgatccagaagctggtagtggc
cgaaaagaaggaaccaaggtcaatttggttgtctcttctgggaagcaatctttccaattg
agcaattacgtcggacgcaagtatacggaagtcgtggctgaactcaaggagaaaaaggtg
ccagaaaatctaatccagatggaagaagaagaatccagcgaaagcgaacccggaaccatc
ctcagacaaacccctgcttcgggttcgacttatgatctctcaaaagccactacgattacc
ttaacagtggctaagaaggtgactagtgtcagcatgccgaactacatcggttcaagtctc
gagtttacaaagaataacttgactcagattgtcggagtaaaagaggctaatattgaggtt
attgaagtatcgactgctcctgaaggaacagcagaaggaactgttgtaagtcaaacacca
aaagctggtgaaaaggttgaccttgctagcacgcgtatcaaactttccatctacaaacca
aaaacaccaccatcaacttcatcctctaatcctgcccaacgtgggaaccaaggttctaca
acaacaccaaatcaagggaaccagcaaggaaatcaacaaggtaataatcctccaacgaat
caaccaaacaatgaaggaaaccgcgaaagttctcgagattaa

DBGET integrated database retrieval system