KEGG   Streptomyces sp. MOE7: STRMOE7_02105Help
Entry
STRMOE7_02105     CDS       T05374                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00010  Glycolysis / Gluconeogenesis
stro00071  Fatty acid degradation
stro00350  Tyrosine metabolism
stro00625  Chloroalkane and chloroalkene degradation
stro00626  Naphthalene degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STRMOE7_02105
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_02105
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    STRMOE7_02105
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STRMOE7_02105
   00626 Naphthalene degradation
    STRMOE7_02105
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STRMOE7_02105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N AlaDh_PNT_C Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ARH89297
UniProt: A0A1W5XHG5
LinkDB All DBs
Position
complement(446411..447457)
Genome map
AA seq 348 aa AA seqDB search
MRAFQLVGWQQPPELREVPVPEPGPGQVLVKVGGAGACHSDLHIMEAPGPPPGFATELPF
TLGHENAGWVESLGSGVTGFASGDPVMVYGPWGCGTCANCREGRENYCQRTSGQGGGLGG
GNDGGMAEYLLVPAARFLIPLGTLDPRQVAPLSDAGLTSYHAVKRSVHLLGPGSTAVVIG
VGGLGQMAIQMVRALSTATTVVAVDTDAGKLETAKRMGADEVLLSGEEAVTRIKNMTGQQ
GAQLVLDMVGMDPTLRMAAQVARVLGHLTIVGLGGGALPVNFASPPHECSVTSPYWGSIP
ELMEVITLAQQKKIKMLIEYFTLAHVNEAYRLLHDGKIQGRAVITPHP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcttttcaactcgtcggatggcagcaaccgcccgagctgcgcgaggtgccggtg
cccgagcccggtccggggcaggtcctggtgaaggtcgggggcgccggtgcgtgccactcg
gatctgcacatcatggaggcacccggaccaccacccgggttcgccacggaactgcccttc
acgctcggccatgagaatgcgggatgggtggagagcctgggatcgggcgtcaccgggttc
gcgtccggagacccggtgatggtctacggtccctggggctgtgggacgtgcgccaactgc
cgtgagggccgggagaattactgccagaggaccagtggtcagggcgggggtctgggaggc
ggtaacgacggtggaatggctgagtacctgctggtcccggcggcgcgattcctgattccg
ctgggcaccctcgacccccgccaggtggccccgctcagcgacgcggggctgaccagctat
cacgccgtcaagcgatcggtgcacctgctgggtccgggctcgaccgcggtggtgatcggg
gtgggcggtctgggccagatggccatccagatggtgcgagcgctcagcacggcgaccacc
gtcgtcgccgtggacaccgatgccggcaagctggaaaccgccaagcgcatgggcgcggac
gaggtgctgctctcgggcgaggaggcggtcacgcgcatcaagaacatgacggggcaacag
ggcgctcagctcgtgctcgacatggtcggcatggacccgactctgcggatggctgctcag
gtggccagggtgctcggccacctgaccatcgtcggtctcggtggcggagccctgcccgtc
aacttcgcgagcccgccgcacgagtgctcggtcacctcgccctactgggggtccattccc
gaactgatggaagtgatcactctcgcccagcagaaaaagatcaagatgctgatcgagtac
ttcaccttggcacacgtcaacgaggcataccggctcctgcacgacggcaagatccaagga
cgcgccgtcatcacccctcacccgtga

DBGET integrated database retrieval system