KEGG   Streptomyces sp. MOE7: STRMOE7_04800Help
Entry
STRMOE7_04800     CDS       T05374                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00360  Phenylalanine metabolism
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00627  Aminobenzoate degradation
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_04800
   00650 Butanoate metabolism
    STRMOE7_04800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_04800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_04800
   00310 Lysine degradation
    STRMOE7_04800
   00360 Phenylalanine metabolism
    STRMOE7_04800
   00380 Tryptophan metabolism
    STRMOE7_04800
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_04800
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_04800
   00281 Geraniol degradation
    STRMOE7_04800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_04800
   00627 Aminobenzoate degradation
    STRMOE7_04800
   00930 Caprolactam degradation
    STRMOE7_04800
Enzymes [BR:stro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ARH89721
UniProt: A0A1W5XIN6
LinkDB All DBs
Position
1052539..1053297
Genome map
AA seq 252 aa AA seqDB search
MGVSTSRPEPGIAVVTMDFPPVNALPVQGWYALADAVRAAGRDPGVRCVVLTAEGRGFNA
GVDIKELQRDAAAGGRQALLGANRGCAEAFSAVYECAVPVVAAVHGFCLGGGIGLAGNAD
AIVASDEAVFGLPELDRGALGAATHLARLVPQHLMRALYYTSRTATADELRAHGSVWRVV
PRDRLGAAARELAGEIARKDGSLLRLAKAALNGIDPVDVHRSYRFEQGFTFEANLSGVAD
RVRDTFGQEART
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctccacctcccggcccgaaccgggcatcgcggtcgtcaccatggacttccca
ccggtcaacgcccttcccgtgcagggctggtacgccctcgccgacgccgtgcgggcggcc
ggccgggaccccggcgtccgctgtgtcgtgctcaccgccgagggccgcggcttcaacgcc
ggggtggacatcaaggagctgcagcgggacgccgcggccggtggacggcaggcgctgctc
ggcgccaaccggggctgcgcggaggcgttctcggcggtgtacgagtgcgcggtgccggtc
gtcgccgcggtgcacgggttctgtctggggggcggaatcgggctggccgggaacgccgac
gcgatcgtggccagcgacgaggccgtcttcggcctgccggagctggaccggggcgcgctc
ggggccgccacccacctcgcccggctcgtcccccagcacctgatgcgcgcgctctactac
acctcgcgcaccgccaccgcggacgagctgcgggcacacggctcggtgtggcgcgtcgtc
ccccgggaccgactgggcgccgcggcaagggaattggccggcgagatcgcccggaaggac
ggctccctcctgcgcctcgccaaggccgcgctcaacggcatcgacccggttgacgtacac
cgcagctaccgcttcgagcagggcttcaccttcgaggcgaacctcagcggcgtcgccgac
cgggtacgcgacaccttcggccaggaggcccggacatga

DBGET integrated database retrieval system