KEGG   Streptomyces sp. MOE7: STRMOE7_04820
Entry
STRMOE7_04820     CDS       T05374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00072  Synthesis and degradation of ketone bodies
stro00280  Valine, leucine and isoleucine degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00620  Pyruvate metabolism
stro00630  Glyoxylate and dicarboxylate metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00900  Terpenoid backbone biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
stro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STRMOE7_04820
   00630 Glyoxylate and dicarboxylate metabolism
    STRMOE7_04820
   00640 Propanoate metabolism
    STRMOE7_04820
   00650 Butanoate metabolism
    STRMOE7_04820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_04820
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_04820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_04820
   00310 Lysine degradation
    STRMOE7_04820
   00380 Tryptophan metabolism
    STRMOE7_04820
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STRMOE7_04820
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_04820
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STRMOE7_04820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stro04147]
    STRMOE7_04820
Enzymes [BR:stro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STRMOE7_04820
Exosome [BR:stro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STRMOE7_04820
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: ARH89724
UniProt: A0A1W5XIM5
LinkDB
Position
complement(1056018..1057184)
AA seq 388 aa
MPEAYIVGAVRTPVGKKGGGLSAVHPADLGAHVLSALMERTGADPAAVEDVVFGCLDAVG
PQAGDIARTCWLAAGLPEDVPGVTVDRQCGSSQQAVHFAAQGVLSGTQDLVVAGGVQNMS
QVPIAFASRQAAEPLGLTDGPFAGSEGWRARYGDAPVNQFHGAELIATRWHLTRRDMEEY
ALRSHQRAVRALDEGRFDREIVPFGQVTADEGPRRGTSLEKMAALPPVVEGGRLTAAVSS
QVSDGAAALLLASGRAVAEHGLTPRARIHHLSVRGEDPIRMLTAPIPATAYALKKAGMTL
DDIDLVEINEAFAPVVLAWLKETGADPERVNVNGGAIALGHPLGATGVRLMTTLLHELER
TGGRFGLQTMCEGGGQANVTIIERLQGR
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgcccgaggcatacatcgtcggcgcggtccgcacccccgtcggcaagaagggcggcggc
ctgtccgccgttcaccccgccgatctgggtgcccatgtgctgtccgcgctgatggagcgc
accggtgccgacccggccgccgtcgaggacgtggtcttcggctgcctggacgcggtcggg
ccgcaggccggggacatcgcccggacgtgctggctggccgccggcctgcccgaggacgtc
cccggcgtcaccgtcgaccggcagtgcggctcctcccagcaggccgtccacttcgccgcg
cagggcgtgctctccggcacccaggacctggtcgtcgccggcggcgtgcagaacatgtcg
caggtcccgatcgccttcgccagccggcaggccgccgagccgctgggcctcaccgacggc
ccgttcgccggatcggagggctggcgggcccgctacggcgacgcccccgtcaaccagttc
cacggcgccgaactgatcgccacccgctggcacctcacccgccgggacatggaggagtac
gcgctgcgctcccaccagcgggccgtccgcgccctcgacgagggccgcttcgaccgcgag
atcgtccccttcgggcaggtcaccgccgacgagggaccgcgccgcggcacctccctggag
aagatggccgccctgccgccggtcgtcgagggcggccggctcaccgcggcggtctcctcg
caggtctccgacggcgcggccgcgctgctgctcgcctccgggcgggcggtggccgagcac
ggcctgaccccgcgggcccgcatccaccatctgtcggtgcgcggcgaggacccgatccgg
atgttgaccgcccccatcccggcgacggcgtacgcgctgaagaaggccggcatgaccctc
gacgacatcgacctggtcgagatcaacgaggcattcgccccggtcgtgctggcctggctg
aaggagaccggcgccgaccccgagcgggtcaacgtcaacggcggcgcgatcgccctgggg
cacccgctcggcgcgaccggcgtccgcctgatgacgacgctgttgcacgaactggagcgc
accggcggccggttcggtctccagaccatgtgcgagggcggcggccaggccaacgtcacc
atcatcgaacgtctccaggggcgctga

KEGG   Streptomyces sp. MOE7: STRMOE7_06575
Entry
STRMOE7_06575     CDS       T05374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00072  Synthesis and degradation of ketone bodies
stro00280  Valine, leucine and isoleucine degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00620  Pyruvate metabolism
stro00630  Glyoxylate and dicarboxylate metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00900  Terpenoid backbone biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
stro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STRMOE7_06575
   00630 Glyoxylate and dicarboxylate metabolism
    STRMOE7_06575
   00640 Propanoate metabolism
    STRMOE7_06575
   00650 Butanoate metabolism
    STRMOE7_06575
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_06575
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_06575
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_06575
   00310 Lysine degradation
    STRMOE7_06575
   00380 Tryptophan metabolism
    STRMOE7_06575
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STRMOE7_06575
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_06575
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STRMOE7_06575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stro04147]
    STRMOE7_06575
Enzymes [BR:stro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STRMOE7_06575
Exosome [BR:stro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STRMOE7_06575
SSDB
Motif
Pfam: Thiolase_N TsaD
Other DBs
NCBI-ProteinID: ARH90016
UniProt: A0A1W5XJH3
LinkDB
Position
complement(1444411..1445589)
AA seq 392 aa
MSNAAHKEPVAVVGIGQTKHVAARRDVSLAGLVREAARRALDDAELSWADIDAVVIGKAP
DFFEGVMMPELYLADALGAVGKPVLRVHTAGSVGGSTALVATNLVAARVHRTVLTLAFEK
QSESNAMWGLSLPIPFQQPLLAGAGGFFAPHVRAYMRRTGAPDTVGSLVAYKDRRNALKN
PYAHLHEEDITLEKVQSSPMLWDPIRYSETCPSSDGACAMVLTDRAGAARSPRPAAWVHG
GAMRSEPTLFAGKDFVSPQAGKDCAADVYRQAGLTDPRRQIDAVEMYVPFSWYEPMWLEN
LGFAEEGEGWKLTEAGVTALDGDLPVNPSGGVLSTNPIGASGMLRFAEAALQVRGQAGAH
QVDGARRALGHAYGGGSQFFSMWLVGADSPAA
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgagcaacgcggcgcacaaggagccggtggccgtcgtcggcatcggccagaccaagcac
gtcgccgcccgccgcgacgtctcgctcgccggactcgtccgcgaggccgcccggcgcgcc
ctggacgacgccgagctgagctgggcggacatcgacgcggtggtgatcggcaaggccccc
gacttcttcgagggcgtcatgatgcccgagctctacctcgccgacgccctgggcgccgtc
ggcaaacccgtgctgcgggtgcacaccgccggctccgtcggcggctccaccgcactggtc
gccacgaacctcgtcgccgcccgggtccaccgcaccgtcctcaccctcgccttcgagaag
cagtccgagtccaacgcgatgtggggactgtcgctgccgatcccgttccagcagcccctg
ctcgccggcgccggcggcttcttcgccccgcacgtgcgcgcgtacatgcggcgcaccggc
gcccccgacacggtcggctccctcgtcgcctacaaggaccgccgcaacgccctgaagaac
ccctacgcgcacctccacgaggaggacatcaccctggagaaggtccagtcctcgcccatg
ctctgggacccgatccgctactccgagacctgcccgtcctccgacggtgcctgtgccatg
gtcctcaccgaccgcgccggggccgcgcgctcgccccgcccggcggcctgggtgcacggc
ggggcgatgcgcagcgagccgaccctcttcgccggcaaagatttcgtctccccgcaggcc
ggcaaggactgcgcggcggacgtctaccggcaggccggcctcaccgacccgcgccggcag
atcgacgcggtggagatgtacgtcccgttcagctggtacgagccgatgtggctggagaac
ctcggcttcgccgaggagggcgagggctggaagctcaccgaggccggcgtcaccgcactc
gacggcgacctcccggtcaacccctccggcggcgtgctctccaccaacccgatcggcgcc
tccggcatgctccgcttcgccgaggccgccctccaggtgcgcggccaggccggcgcacac
caagtcgacggcgcgcggcgggcgttggggcacgcgtacggcggcggctcccagttcttc
tccatgtggctggtcggcgccgactcaccggccgcctga

KEGG   Streptomyces sp. MOE7: STRMOE7_12490
Entry
STRMOE7_12490     CDS       T05374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00072  Synthesis and degradation of ketone bodies
stro00280  Valine, leucine and isoleucine degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00620  Pyruvate metabolism
stro00630  Glyoxylate and dicarboxylate metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00900  Terpenoid backbone biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
stro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STRMOE7_12490
   00630 Glyoxylate and dicarboxylate metabolism
    STRMOE7_12490
   00640 Propanoate metabolism
    STRMOE7_12490
   00650 Butanoate metabolism
    STRMOE7_12490
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_12490
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_12490
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_12490
   00310 Lysine degradation
    STRMOE7_12490
   00380 Tryptophan metabolism
    STRMOE7_12490
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STRMOE7_12490
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_12490
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STRMOE7_12490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stro04147]
    STRMOE7_12490
Enzymes [BR:stro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STRMOE7_12490
Exosome [BR:stro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STRMOE7_12490
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Other DBs
NCBI-ProteinID: ARH90998
UniProt: A0A1W5XMC0
LinkDB
Position
complement(2806633..2807802)
AA seq 389 aa
MAAEPVIVEAVRTPIGKRQGALANLHPAYLLGETYRELLARTGIQPDCIEQIVSGTVTHA
GEQSMNPARNAWLAMGLPYETAATTVDCQCGSSQQANHMVANMIAGGVIDIGIGSGVEAM
SRVPLGSGSKHGPGKPWPDEWNVDLPNQFEAAERIARHRGLTRENVDSLGLISQERAAAA
WAEERFKRETFAVQVPTTEEEQAAGQGMWRLVDRDEGLRDTSMEALGGLKPVMPTAVHTA
GNSSQISDGAAAVMWASKRMARALKLKPRARIVAQALVGSDPHFHLDGPIDATRAVLGKA
GMSLKDIDLVEINEAFASVVLSWAKVFDQDLEKVNVNGGAIALGHPVGATGARLITTALH
ELERRDKEFALITMCAGGALATATIIQRL
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggccgcggaacccgtcatcgtcgaagccgtacgcaccccgatcggcaagcgccagggc
gcgctcgccaacctccaccccgcctatctcctgggcgagacctaccgcgaactcctcgcc
cgtacgggcatccagcccgactgcatcgaacagatcgtcagcggcaccgtcacccacgcc
ggagaacagtccatgaacccggcgcgcaacgcctggctggcgatgggcctcccgtacgag
accgcggcgaccaccgtggactgccagtgcggctcctcccagcaggccaaccacatggtc
gccaacatgatcgcgggcggcgtcatcgacatcggcatcggcagcggcgtcgaggcgatg
tcccgggtgccgctcggcagcggctccaagcacggccccggcaagccctggcccgacgag
tggaacgtcgatctgcccaaccagttcgaggcggccgaacgcatcgcccgccaccggggg
ctgacccgcgagaacgtcgactcgctcggcctcatctcccaggagcgggcggcagccgcc
tgggccgaggagcgcttcaaacgggagacgttcgccgtccaggtccccaccaccgaggag
gagcaggctgcgggccagggcatgtggcggctggtcgaccgcgacgaggggctgcgcgac
accagcatggaggcgctcggcggcctcaagcccgtcatgccgacggccgtgcacacggcg
ggcaactcctcgcagatctccgacggcgccgccgcggtcatgtgggcctccaagcggatg
gcgcgcgccctcaaactcaagccgcgggcccgcatcgtggcgcaggcgctggtcggctcc
gatccgcacttccatctggacggcccgatcgacgccacccgcgccgtgctcggcaaggcc
gggatgtccctcaaggacatcgacctggtcgagatcaacgaggcgttcgcctccgtcgtg
ctctcctgggcgaaagtcttcgaccaggacctggagaaggtgaacgtgaacggcggcgcc
atcgccctcgggcacccggtcggcgccaccggtgcccgcctgatcaccacggcgctgcac
gaactggaacgccgggacaaggaattcgccctgatcaccatgtgcgcgggcggtgcgctg
gccaccgcgacgatcatccagcggctctga

KEGG   Streptomyces sp. MOE7: STRMOE7_16010
Entry
STRMOE7_16010     CDS       T05374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00072  Synthesis and degradation of ketone bodies
stro00280  Valine, leucine and isoleucine degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00620  Pyruvate metabolism
stro00630  Glyoxylate and dicarboxylate metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00900  Terpenoid backbone biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
stro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STRMOE7_16010
   00630 Glyoxylate and dicarboxylate metabolism
    STRMOE7_16010
   00640 Propanoate metabolism
    STRMOE7_16010
   00650 Butanoate metabolism
    STRMOE7_16010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_16010
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_16010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_16010
   00310 Lysine degradation
    STRMOE7_16010
   00380 Tryptophan metabolism
    STRMOE7_16010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STRMOE7_16010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_16010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STRMOE7_16010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stro04147]
    STRMOE7_16010
Enzymes [BR:stro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STRMOE7_16010
Exosome [BR:stro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STRMOE7_16010
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: ARH91555
UniProt: A0A1W5XP40
LinkDB
Position
3639566..3640786
AA seq 406 aa
MPEAVIVSAARSPIGRAFKGSLKDLRPDDLTAKIIETALAKVPELDPRDIDDLMLGCGLP
GGEQGHNLGRIVAVQMGMDHLPGCTVTRYCSSSLQTTRMALHAIKAGEGDVFISAGVETV
SRSVKGSSDGLPDTHNPLFADAEARTAARAEQEGADWHDPREDGLIPDAYIAMGQTAENL
ARLKGVTRQDMDEFGVRSQNLAEKAIKDGFWEREITPVTLPDGTVVSQDDGPRAGVTVEG
VSGLKPVFRPDGLVTAGNCCPLNDGAAALVIMSDTKARELGLTPLARIVSTGVSGLSPEI
MGYGPVEASKQALRRAGLSVSDIDLVEINEAFAAQVIPSYRDLGIDLDRLNVNGGAIAVG
HPFGMTGARITTTLINSLQWHDKQFGLETMCVGGGQGMAMVIERLS
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgcccgaagccgtgatcgtctcagccgcccgctccccgatcggccgcgccttcaagggc
tcgctcaaggacctgcgtccggacgacctgaccgcgaagatcatcgagaccgccctcgcc
aaggtcccggagctggacccccgggacatcgacgacctgatgctcggctgcggcctgccg
ggcggcgagcagggccacaacctcggccgcatcgtggccgtccagatggggatggaccac
ctccccggctgtacggtcacccgctactgctcctcctcgctccagacgacccgcatggcg
ctgcacgccatcaaggccggcgagggcgacgtcttcatctcggccggcgtcgagaccgtc
tcgcgcagcgtcaagggcagctccgacggcctcccggacacccacaacccgctcttcgcc
gacgccgaggcccgcaccgcggcccgcgccgagcaggagggcgcggactggcacgacccg
cgcgaggacggcctgatcccggacgcgtacatcgcgatgggccagaccgcggagaacctt
gcccgcctcaagggcgtcacccgccaggacatggacgagttcggcgtacggtcccagaac
ctcgccgagaaggcgatcaaggacggcttctgggagcgggagatcaccccggtcacgctg
cccgacggcacggtcgtctcccaggacgacggcccgcgcgccggcgtcaccgtcgagggc
gtctccggcctcaagccggtcttccgccccgacggcctggtgaccgccggcaactgctgc
ccgctgaacgacggcgccgcggcgctggtcatcatgtccgacaccaaggcgcgcgagctg
ggcctgacgccgctggcgcggatcgtctccaccggcgtctccggcctgtcccccgagatc
atggggtacggcccggtcgaggccagcaagcaggccctgcggcgcgccggcctctcggtc
tccgacatcgacctggtcgagatcaacgaggcgttcgccgcccaggtgatcccctcctac
cgggacttgggcatcgacctggaccggctgaacgtcaacggcggcgcgatcgccgtcggc
caccccttcggcatgaccggcgcccgcatcaccaccaccctgatcaactccctccagtgg
cacgacaagcagttcggcctggagaccatgtgcgtcggcggcggccagggcatggcgatg
gtgatcgagcggctgagctga

KEGG   Streptomyces sp. MOE7: STRMOE7_26450
Entry
STRMOE7_26450     CDS       T05374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00072  Synthesis and degradation of ketone bodies
stro00280  Valine, leucine and isoleucine degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00620  Pyruvate metabolism
stro00630  Glyoxylate and dicarboxylate metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00900  Terpenoid backbone biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
stro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STRMOE7_26450
   00630 Glyoxylate and dicarboxylate metabolism
    STRMOE7_26450
   00640 Propanoate metabolism
    STRMOE7_26450
   00650 Butanoate metabolism
    STRMOE7_26450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_26450
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_26450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_26450
   00310 Lysine degradation
    STRMOE7_26450
   00380 Tryptophan metabolism
    STRMOE7_26450
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STRMOE7_26450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_26450
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STRMOE7_26450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stro04147]
    STRMOE7_26450
Enzymes [BR:stro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STRMOE7_26450
Exosome [BR:stro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STRMOE7_26450
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Other DBs
NCBI-ProteinID: ARH95553
UniProt: A0A1W5Y0D3
LinkDB
Position
5930721..5931896
AA seq 391 aa
MIVAGARTPMGRLLGSLRTFSGADLGGFAIKAALDRAGIGGDQVQYVIMGQVLQAGAGQI
PARQAAVKAGIPMNVPALTVNKVCLSGLDAIALADQLIRAGEFDVIVAGGQESMTNAPHL
LPKSREGYKYGAVEMLDAMAHDGLTDAFEGIAMGESTEKHNTRLGIARPEQDEVAARSHQ
RAAAAQKNGLFEAEITPVEIPQRKGEPVVFAKDEGIRGETTAESLGKLRPAFAKDGTITA
GTSSQISDGAAAVVVMSKAKAEQLGLEWIAEIGAHGNVAGPDNSLQSQPSNAINHALGKE
GLTVQDLDLIEINEAFAAVAVQSMKDLGVSPEKVNVNGGAIALGHPIGMSGARIVLHLAL
ELRRRGGGVGAAALCGGGGQGDALIIRVPGK
NT seq 1176 nt   +upstreamnt  +downstreamnt
gtgatcgtggcgggcgcgcgcacccccatgggccggctcctggggtccctgcggaccttc
tcgggcgccgatctgggcggcttcgccatcaaggcggcgctggaccgggcgggcatcggc
ggtgaccaggtgcagtacgtgatcatgggccaggtgctgcaggccggggcggggcagatc
ccggcgcgccaggcggcagtcaaggccggcatcccgatgaacgtccccgcgctgaccgtc
aacaaggtctgtctctcgggcctcgacgccatcgcgctggccgaccagctcatccgcgcc
ggcgagttcgacgtgatcgtcgccggcggccaggagtccatgaccaacgccccgcacctg
ctccccaagtcgcgggagggctacaagtacggcgccgtcgagatgctcgacgcgatggcc
cacgacggcctcaccgacgccttcgaaggcatcgccatgggcgagtcgaccgagaagcac
aacacccggctgggaatcgcccgtccggagcaggacgaggtcgccgcgcgctcccaccag
cgggccgccgccgcccagaagaacgggctcttcgaggccgagatcacccccgtggagatc
ccgcagcgcaagggcgagccggtcgtcttcgccaaggacgagggcatccgcggggagacc
acggcggagtcgctgggcaagctgcgcccggcgttcgccaaggacggcacgatcaccgcc
ggcacctcctcgcagatctccgacggcgcggccgccgtcgtggtgatgagcaaggccaag
gccgagcagctgggcctggagtggatcgccgagatcggtgcgcacggcaacgtcgcgggc
ccggacaactcgctgcagtcccagccgtccaacgcgatcaaccacgcgctgggcaaggaa
ggactgaccgtccaggatcttgacctgatcgagatcaacgaggcgttcgcggccgtcgcg
gtgcagtcgatgaaggatctcggggtgtcccccgaaaaggtgaatgtcaacggcggtgcc
atcgcgctgggtcacccgatcggcatgtccggcgcccgcatcgtgctgcacctcgcactg
gagctgcgccggcgcggcggcggcgtgggtgccgcggcgctgtgtggtggcggtggtcag
ggcgacgcgctgatcattcgcgtaccgggtaagtaa

KEGG   Streptomyces sp. MOE7: STRMOE7_31695
Entry
STRMOE7_31695     CDS       T05374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00072  Synthesis and degradation of ketone bodies
stro00280  Valine, leucine and isoleucine degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00620  Pyruvate metabolism
stro00630  Glyoxylate and dicarboxylate metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00900  Terpenoid backbone biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
stro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STRMOE7_31695
   00630 Glyoxylate and dicarboxylate metabolism
    STRMOE7_31695
   00640 Propanoate metabolism
    STRMOE7_31695
   00650 Butanoate metabolism
    STRMOE7_31695
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_31695
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_31695
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_31695
   00310 Lysine degradation
    STRMOE7_31695
   00380 Tryptophan metabolism
    STRMOE7_31695
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STRMOE7_31695
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_31695
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STRMOE7_31695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stro04147]
    STRMOE7_31695
Enzymes [BR:stro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STRMOE7_31695
Exosome [BR:stro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STRMOE7_31695
SSDB
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C DUF5423
Other DBs
NCBI-ProteinID: ARH94100
UniProt: A0A1W5XW32
LinkDB
Position
7214883..7216097
AA seq 404 aa
MSTEAYVYDAIRTPRGRGKANGALHGTKPIDLVVGLIHEVRNRFPGLDPAAIDDIVLGVV
GPVGDQGSDIARIAAIAAGLPDTVAGVQENRFCASGLEAVNMAAAKVRSGWEDLVLAGGV
ESMSRVPMASDGGAWFADPMTNFDTGFVPQGIGADLIATLEGYSRRDVDEFAALSQERAA
EAWKDGRFDRSVVPVRDRNGLVVLDHDEHMRPGTTADSLAGLKPSFATIGDAGGFDAVAL
QKYHWVEKIDHVHHAGNASGIVDGAALVAIGSKEVGERYGLTPRARILAAAVSGSEPTIM
LTGPAPASRKALAKAGLTIDDIDLVEINEAFAAVVLRFVKDMGLSLDKVNVNGGAIAMGH
PLGATGAMILGTLIDELERQDKRYGLATLCVGGGMGIATVIERL
NT seq 1215 nt   +upstreamnt  +downstreamnt
gtgagcaccgaagcgtacgtatacgacgcgatccgcaccccgcgcggccgcggcaaggcc
aatggcgcactgcacggcaccaagccgatcgacctggtcgtcggcctgatccacgaagtg
cgcaaccgcttcccgggcctcgacccggccgccatcgacgacatcgtgctcggcgtcgtc
ggaccggtcggcgaccagggctccgacatcgcccggatcgcggcgatcgccgcggggctg
cccgacaccgtcgccggcgtacaggagaaccgcttctgcgcgtccggcctcgaagccgtc
aacatggccgccgccaaggtgcgttcgggctgggaggacctggtcctggcgggcggtgtc
gaatccatgtcgcgggtcccgatggcctccgacggcggcgcctggttcgccgacccgatg
accaacttcgacaccggcttcgtcccccagggcatcggtgccgacctcatcgccaccctt
gagggctacagccggcgcgacgtcgacgagttcgccgcgctctcccaggagcgggccgcc
gaggcgtggaaggacggccgcttcgaccgctccgtggtcccggtgcgcgaccgcaacggc
ctggtcgtcctcgaccacgacgagcacatgcgccccggcaccaccgccgactccctcgcc
ggcctcaagccgtccttcgccaccatcggcgacgccggcggcttcgacgcggtcgccctg
cagaagtaccactgggtcgagaagatcgaccacgtccaccacgccggcaacgcctccggc
atcgtggacggcgcggcgctcgtcgccatcggctccaaggaggtcggcgagcgctacggc
ctcaccccgcgggcccgcatcctcgcggccgcggtctccggctccgagccgacgatcatg
ctcaccggccccgcgcccgccagccgcaaggcgctggccaaggccgggctgaccatcgac
gacatcgacctggtcgagatcaacgaggcgttcgccgccgtcgtactgcgcttcgtcaag
gacatgggcctgagcttggacaaggtcaacgtcaacggcggcgccatcgccatgggccac
ccgctgggcgccaccggcgcgatgatcctcggcaccctcatcgacgagctggagcggcag
gacaagcgctacggcctggccaccctctgcgtcggcggcggcatgggcatcgccaccgtc
atcgagcgcctctga

KEGG   Streptomyces sp. MOE7: STRMOE7_33140
Entry
STRMOE7_33140     CDS       T05374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00072  Synthesis and degradation of ketone bodies
stro00280  Valine, leucine and isoleucine degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00620  Pyruvate metabolism
stro00630  Glyoxylate and dicarboxylate metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00900  Terpenoid backbone biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
stro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STRMOE7_33140
   00630 Glyoxylate and dicarboxylate metabolism
    STRMOE7_33140
   00640 Propanoate metabolism
    STRMOE7_33140
   00650 Butanoate metabolism
    STRMOE7_33140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_33140
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_33140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_33140
   00310 Lysine degradation
    STRMOE7_33140
   00380 Tryptophan metabolism
    STRMOE7_33140
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STRMOE7_33140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_33140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STRMOE7_33140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stro04147]
    STRMOE7_33140
Enzymes [BR:stro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STRMOE7_33140
Exosome [BR:stro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STRMOE7_33140
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: ARH95695
UniProt: A0A1W5Y0V8
LinkDB
Position
complement(7559149..7560360)
AA seq 403 aa
MTDATGYDLPDDRQPVVVAARRTPIGRAGGALAGVEASQLLATVIGEVLADARADAAEVG
EVIVGNAAGGGGNLARLAALEAGLPTEVPGVTVDRQCGSGLEAIVLACRMVAAGAGEVYL
AGGGESVSTAPWRVRQPSRPGGLPEFYARARFAPESAGDPDMGVAAENVATRYGIGRRRQ
DEFALRSHRRAVAAQQDGRFTAEITPVRTARGTVTVDECPRPDTSLAALSALRPLFAAPG
EGTVTAGNSCPLNDGAAMVVVTSRSQARALGHRRVLGFVEASAAGVDPNLLGIGPIASTR
RLLARCPDLATAERIEFNEAFAAQVLASLDALGVAEERINLDGGALALGHPFGASGAVLV
TRLFTQLVRAPAPDLPLGARGLAMLGIAGGLGLTALFASQGTD
NT seq 1212 nt   +upstreamnt  +downstreamnt
gtgactgacgccaccgggtacgacctccccgacgaccggcagccggtggtggtcgccgcc
cgccggaccccgatcggccgggccggcggcgcgctggccggcgtcgaggcgtcgcagctg
ctggcgaccgtgatcggggaggtgctggccgacgcgcgcgccgacgcggcggaggtcggt
gaggtcatcgtcgggaacgcggccggcgggggcggcaacctcgcgcggctggccgcgctg
gaggcgggactgccgacggaggtgcccggcgtcaccgtggaccggcagtgcggctccggg
ctggaggcgatcgtcctcgcctgccgcatggtggccgccggggccggcgaggtgtatctc
gcgggcggcggcgagagcgtcagcaccgccccctggcgggtgcggcagccgtcccgcccg
ggcgggctccccgagttctacgcccgcgcccgcttcgccccggagtcggcgggcgacccc
gacatgggcgtggccgcggagaacgtcgccacccgttacggcatcggccgccgccggcag
gacgagttcgccctgcgcagccaccggcgcgccgtcgcggcacagcaggacggccgtttc
accgccgagatcaccccggtgcgcacggcccgtggcacggtcaccgtcgacgagtgcccg
cgccccgacacctccctggccgcgctgtccgcgctgcggccgctcttcgccgcccccggc
gagggcacggtcaccgcgggcaactcctgtccgctgaacgacggcgcggccatggtcgtg
gtcaccagccggtcgcaggcccgcgcgctgggccaccgtcgcgtcctcggcttcgtcgag
gcgagcgcggccggtgtggaccccaatctgctgggcatcggcccgatcgcgtcgacccgg
cgcctgctcgcccggtgcccggacctcgccaccgccgaacgcatcgagttcaacgaggcg
ttcgccgcccaggtcctggcctcgctcgacgcgctgggcgtcgccgaggagcggatcaac
ctcgacggcggtgccctcgccctcggccatcccttcggtgcctccggcgcggtcctggtg
actcgcctcttcacccaactcgtccgcgcgcccgcgccggacctcccgctcggcgcccgc
ggcctggccatgctgggcatcgccggcggactgggactcaccgcgctgttcgcctcgcag
gggacggactga

DBGET integrated database retrieval system