KEGG   Streptomyces sp. MOE7: STRMOE7_05000Help
Entry
STRMOE7_05000     CDS       T05374                                 

Definition
(GenBank) sarcosine dehydrogenase
  KO
K00309  dimethylglycine oxidase [EC:1.5.3.10]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00260  Glycine, serine and threonine metabolism
stro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STRMOE7_05000
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.10  dimethylglycine oxidase
     STRMOE7_05000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T DAO FAO_M GCV_T_C Pyr_redox NAD_binding_8 Pyr_redox_2 FAD_binding_2 Amino_oxidase FAD_binding_3 SoxG Lycopene_cycl TrkA_N Shikimate_DH Trp_halogenase ThiF GMC_oxred_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ARH89756
UniProt: A0A1W5XIT8
LinkDB All DBs
Position
complement(1099005..1101446)
Genome map
AA seq 813 aa AA seqDB search
MSRTPANSARVVVIGAGIVGCSLADELTARGWTDVTVLEQGPLPAPGGSTSHAPGLVFQT
GPSKTMTEFAAYTVRKLGSLEVDGLPCFNAVGGLEVATTEARWADLHRKAGLAASWGVRG
ALLTPEQCKRLWPMLDETKLFGGLHTPDDGLARALLACRAQMERAASRGARFLERHTVTG
IERADGHVTGVVTDRGTFPADHVVSAAGFWGPVIGAMAGVDVPLQPLAHQYATTAPLPEL
AGVNDPRNEASKPILRFQDRDLYFREHTDRLGIGSYAHRPMPVDPRTVPAFDDAPLMPSS
LPFTEEDFAPSWQDSVGLLPALGASEVAAGFNGVFSFTPDGMPLLGESRDLRGFWLAEAV
WVTHSAGVAKAVAEWMTDGRPAVDVHECDLHRFEDAQRSPAYIADRGAQSFVEVYDVIHP
LQPMEQPRPLRTSPFHPRQQELGAYFLEGGGWERPHWYEANAPLVEGLELPERDAWSARY
WSPIAAAEARATRERVALYDMTPLRRLEVTGPGALDFLHAMTSNNLRKKPGAVTYTLLLD
ETGGIRSDLTVARLGTDRFQVGANSPADLDWLLRHAPEGVQIRDITSGTCCVGVWGPLAR
DLVQPLTRDDFSHEGFGYFRAKQTYLGHVPVTAMRLSYVGELGWELYTTADLGLRLWDTL
WEAGQQHGVLAAGRSAFNSLRLEKGYRAWGTDMTDEHDPYEAGLGFAVRLDKEFTGRAAL
EGKQTPARKLTALLLDDPAANVLGKEPVHLDGVPAGYVTSAAYGYTLGRCVAYAWLPVLP
AGTAVHVEYFGEKLPATVADEPLFDPKMTRIRR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtacgcccgcaaacagtgcccgtgtggttgtcatcggtgccggcatcgtcggc
tgctccctggccgacgaactgaccgcccgcggctggaccgacgtcacggtcctcgaacag
ggcccgctgccggcccccggcggctccacctcgcacgcaccgggcctggtcttccagacc
ggcccctccaagaccatgaccgagttcgccgcctacaccgtacggaagctgggctccctg
gaggtcgacggcctgccctgcttcaacgccgtcggcgggctggaggtcgccaccaccgag
gcccgctgggccgatctgcaccgcaaggccgggctcgccgcctcctggggcgtacgcggg
gcactgctcacccccgagcagtgcaagcggctgtggccgatgctcgacgagaccaagctc
ttcggcggcctccacacccccgacgacggactggcccgcgccctgctcgcctgccgcgcc
cagatggagcgggccgcctcccgcggtgcccgcttcctcgaacggcacaccgtcaccggc
atcgagcgcgccgacggccacgtcaccggcgtcgtcaccgaccggggcaccttccccgcc
gatcacgtcgtgtccgccgccggtttctggggcccggtgatcggggcgatggccggggtg
gacgtgccgctgcagccgctggcccaccagtacgccaccaccgcgccgttgcccgaactc
gccggcgtcaacgaccctcgcaacgaggccagcaagccgatcctgcgcttccaggaccgc
gatctgtacttccgcgagcacaccgaccggctgggcatcggctcctacgcccaccggccg
atgcccgtcgacccgcgcaccgtccccgccttcgacgacgcgcccctcatgccgtcctcg
ctgcccttcacggaggaggacttcgcaccgagctggcaggacagcgtcggactgctgccc
gcactgggcgcgtccgaggtggccgcaggcttcaacggggtcttctccttcacgcccgac
gggatgcccctgctcggcgaatcccgtgacctgcgcggattctggctcgccgaggcggtc
tgggtcacccactccgcgggcgtcgccaaggccgtcgccgagtggatgaccgacggccgg
cccgccgtcgacgtccatgagtgcgacctccaccgcttcgaggacgcccagcgctcaccc
gcgtacatcgccgaccgcggtgcccagagcttcgtcgaggtctatgacgtcatccacccg
ctgcagcccatggagcagccccggccgctgcgcaccagccccttccacccgcgccagcag
gagctcggcgcgtacttcctggagggcggcgggtgggagcgcccgcactggtacgaggcg
aacgcaccgctcgtcgaggggctcgaactccccgagcgggacgcctggtcggcacgctac
tggtcgccgatcgccgcggccgaggcgagggcgacgcgcgagcgggtcgccctgtacgac
atgacgccgctgcgcaggctggaggtgaccgggcccggagccctggacttcctgcacgcg
atgaccagcaacaacctccgcaagaagcccggcgcggtcacctacacgctgctcctcgac
gagaccggcggcatccgctccgacctcaccgtcgcccgcctgggcaccgaccgcttccag
gtcggcgccaactccccggcggatctcgactggttgctgcggcacgcccccgagggagtg
cagatccgcgacatcacctcgggcacctgctgcgtcggcgtctgggggccgctcgcccgc
gacctcgtccagccgctgacccgcgacgacttctcccacgagggcttcggctacttccgc
gccaagcagacctacctcggccacgtaccggtgacggcgatgcggctgagctacgtcggc
gagctgggctgggagctgtacaccacggccgacctggggctgcggctgtgggacacgctg
tgggaggccgggcagcagcacggcgtgctggcggccggccgctcggccttcaactccctc
cgcctggagaagggttaccgcgcctggggcaccgacatgaccgacgagcacgacccgtac
gaggcgggcctcggcttcgccgtccgcctggacaaggagttcaccggacgggccgccctc
gaagggaagcagaccccggcccgcaagctcaccgcgctgctcctcgacgaccctgccgcc
aacgtcctcggcaaggagcccgtccacctcgacggcgtaccggcgggctacgtcaccagc
gccgcgtacggctacacgctgggccgctgcgtcgcctacgcctggctgccggtgctcccc
gccggcaccgcagtgcacgtcgagtacttcggcgagaagctcccggcgaccgtcgccgac
gagccgctgttcgacccgaagatgacccgcatccgccgctga

DBGET integrated database retrieval system