KEGG   Streptomyces sp. MOE7: STRMOE7_05040Help
Entry
STRMOE7_05040     CDS       T05374                                 

Definition
(GenBank) hypothetical protein
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NfeD
Motif
Other DBs
NCBI-ProteinID: ARH89763
UniProt: A0A1W5XIQ7
LinkDB All DBs
Position
1107957..1108181
Genome map
AA seq 74 aa AA seqDB search
MSARDDTDFSPIGLIGRVTVSIPAGGPGEVLLPVRGGTESFAAWSREPIARHTQVIVVDH
TSARSVIVAPLPAT
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgagggatgacacggacttcagcccgatcgggttgatcgggcgggtgaccgtg
tcgatcccggccggcgggcccggcgaggtgctgctgccggtgcgcggcgggaccgagtcc
ttcgccgcctggtcccgggagcccatcgcgcggcacacgcaggtcatcgtggtggaccac
acctcggcgcggtcggtgatcgtcgcgccgctgcccgccacctga

DBGET integrated database retrieval system