KEGG   Streptomyces sp. MOE7: STRMOE7_05055Help
Entry
STRMOE7_05055     CDS       T05374                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STRMOE7_05055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:stro01002]
    STRMOE7_05055
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stro01011]
    STRMOE7_05055
Enzymes [BR:stro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STRMOE7_05055
   3.4.21  Serine endopeptidases
    3.4.21.-  
     STRMOE7_05055
Peptidases and inhibitors [BR:stro01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   STRMOE7_05055
Peptidoglycan biosynthesis and degradation proteins [BR:stro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   STRMOE7_05055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 DUF3693
Motif
Other DBs
NCBI-ProteinID: ARH89765
UniProt: A0A1W5XIT7
LinkDB All DBs
Position
complement(1110208..1111827)
Genome map
AA seq 539 aa AA seqDB search
MSPTARRRRIPRRAVVTLALLLSVGIVVTGLVQAAPQPSPTPAPARGGLGPRLAAVMGKP
AYRHAQWGLFQQNPRTGRVLQSRFADQFFIPGSTAKLFSVSGTWHTLGGDHRFVTPVYAV
GQRRHATLRGDLVLVAQGDLTLGGRTRKDGTIAYTPIDHTYANDIPGATLTPENPLAGLD
HLARQVRAAGIRRVDGDVVVDARLFRPDPDLDPTPTPMIVNDNVIDLLTSPGRAAGSPAA
LEVRPKVAPYRVTSSVRTVAPGKPTAIAVRTSPDGTRIQLSGTIAAGSAPVLRISPVKDP
DAFGRTALIEALRRAGVQVTANPVGPRPAARLPRSYQGVPAVAHYTSPPYREYAKLILKV
SHNLGANLGVCLMATTAGSTDCEDGFPVLAAFLDAAKVDRKAVQLADGRGGNPADRTTPR
ALAQILTYWQRTGEARNFREALPVLGVDGTLADSCRHCPSRGKVFAKTGTAAGGDALNDR
LAVGAETVAGYLETGKGRFDVFFVGVNGAATPTAAIQGVLTIGDDVADAAALLQQKSGG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccaaccgcccggcgccggaggatcccccggcgcgccgtcgtcacgctggcgctc
ctgctgtccgtcggtatcgtcgtcaccggcctcgtccaggccgctccgcaaccgtccccg
acgcccgcaccggcccgcggcggcctcggcccgcgcctcgcggcggtcatgggcaaaccc
gcgtaccggcacgcccaatggggactgttccagcagaacccgcggacgggcagggtgctg
cagtcccgcttcgccgaccagttcttcatccccggctcgacggccaaactgttcagcgtc
agcggcacctggcacaccctcggcggcgaccaccgcttcgtcaccccggtgtacgccgtc
gggcagcgccgtcacgcgacgctcaggggtgacctggtcctggtggcacagggcgacctg
accctcggcggacggacccgcaaggacggcaccatcgcctacacccccatcgaccacacc
tacgccaacgacatccccggagccaccctcaccccggagaacccgctggccggcctcgac
cacctcgcccgtcaggtgcgcgccgcggggatccggcgggtcgacggcgatgtcgtcgtc
gacgcccggctgttccggcccgacccggatctcgacccgacgcccaccccgatgatcgtc
aacgacaacgtcatcgatctgctgacctcccccgggcgcgccgccggcagccccgccgcc
ctggaggtgcgtccgaaagtcgcgccctaccgggtcacctcgtccgtccgcaccgtcgca
cccggcaaacccaccgccatcgccgtacggacctcgcccgacggcacccggatccagctg
tccggcaccatcgccgccggctccgcccccgtcctgcggatctccccggtcaaggatccc
gacgcgttcggtcggaccgccctgatcgaggcgctgcgccgggccggggtccaggtcacc
gcgaaccccgtcggcccgcgccccgccgcccggctgccccgctcctaccagggcgtgccc
gcggtggcccactacacctccccgccgtaccgcgagtacgccaaactgatcctcaaggtg
agccacaacctcggggcgaacctcggggtgtgcctgatggccacgaccgccgggagcacc
gactgcgaggacggcttccccgtgctcgccgcgttcctggacgccgcgaaggtggaccgc
aaggccgtacagctcgccgacggccggggcggcaacccggccgaccggaccacgccccgg
gcgctggcacagatcctgacgtactggcagcgcaccggtgaggcccggaacttccgcgag
gcgttgccggtcctgggcgtcgacgggaccctggcggactcctgccggcactgcccgtca
cgcggcaaggtcttcgcgaagaccggcaccgcggcgggcggcgacgccctcaacgaccgg
ctggccgtcggtgccgagaccgtcgccggttatctggagaccggtaagggccgcttcgac
gtcttcttcgtcggggtcaacggcgccgccacccccaccgccgccatccagggcgtgctg
accatcggcgacgacgtggccgatgccgccgccctcctgcagcagaagagcggcggctga

DBGET integrated database retrieval system