KEGG   Streptomyces sp. MOE7: STRMOE7_05060Help
Entry
STRMOE7_05060     CDS       T05374                                 

Definition
(GenBank) hypothetical protein
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LCE6A
Motif
Other DBs
NCBI-ProteinID: ARH89766
UniProt: A0A1W5XIV0
LinkDB All DBs
Position
complement(1111981..1112397)
Genome map
AA seq 138 aa AA seqDB search
MLRSIPRGLAVAGLTAAALVLPTAGAATAAPSSTPTPVCSSHGCERGHHGKGQDNAHGRS
GHGGHNAHRRNGRDGYDDFGRDGGRRDGFGYGRDGYGRDGYGRDGYGYGRDGYGRDGYGR
DGYGPGRGLFGLGLLGLL
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgctccgttcgatccctcgcggcctcgcggtggccggcctgaccgcggctgccctggtg
ctgccgacggctggcgccgcgaccgccgcccccagcagcacgcccacccccgtgtgctcc
tcgcacggctgcgaacgtggccaccacggcaaggggcaggacaacgcccacggccgctcc
ggccacggcggccacaacgcccaccgccgcaacggccgcgacggctacgacgacttcggc
cgtgacggcggccgccgcgacggcttcggctacggccgtgacggctacggccgcgacggg
tatggccgcgacggctacgggtacggccgtgacggctacggccgcgacgggtacggccgc
gacggctacggcccgggccgcggcctgttcggcctcggcctgctcgggctcctctga

DBGET integrated database retrieval system