KEGG   Streptomyces sp. MOE7: STRMOE7_05075Help
Entry
STRMOE7_05075     CDS       T05374                                 

Definition
(GenBank) cytochrome
  KO
K05337  ferredoxin
Organism
stro  Streptomyces sp. MOE7
Brite
KEGG Orthology (KO) [BR:stro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    STRMOE7_05075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_13 Fer4_15 Fer4_19
Motif
Other DBs
NCBI-ProteinID: ARH89768
UniProt: A0A1W5XIT4
LinkDB All DBs
Position
1114493..1114708
Genome map
AA seq 71 aa AA seqDB search
MTWKVEIDPQQCIASGSCPAIAPDLFVVDGAHARPLKDVIEEDERALDAADVCPAMAITV
RDGERVVGPRP
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtggaaggtggagatcgacccccagcagtgcatcgcctcgggctcctgccccgcc
atcgcccccgacctcttcgtcgtggacggcgcgcacgcccggcccctgaaggacgtgatc
gaggaggacgagcgggcgctggacgcggccgatgtctgtcccgcgatggcgatcaccgtg
cgggacggcgagcgggtcgtcggcccccgcccctag

DBGET integrated database retrieval system