KEGG   Streptomyces sp. MOE7: STRMOE7_05160Help
Entry
STRMOE7_05160     CDS       T05374                                 

Definition
(GenBank) Rrf2 family transcriptional regulator
  KO
K13771  Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor
Organism
stro  Streptomyces sp. MOE7
Brite
KEGG Orthology (KO) [BR:stro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:stro03000]
    STRMOE7_05160
Transcription factors [BR:stro03000]
 Prokaryotic type
  Helix-turn-helix
   Rrf2 family
    STRMOE7_05160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 HTH_27 TrmB HTH_Crp_2 GntR
Motif
Other DBs
NCBI-ProteinID: ARH89784
UniProt: A0A1W5XIT3
LinkDB All DBs
Position
1128205..1128651
Genome map
AA seq 148 aa AA seqDB search
MRLTKFTDLALRAVMRLAVSTQDVSMTTREVAEAMEVPYAHMAKAVTRLQHLGVVDARRG
RGGGLELTELGRQASVGWLVRELEGDDEVVACEGGPPCPLRAACRLRGALRTAQEAFYAA
LDPLTVGELVASPTGPVLLGLVGGPRTP
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtgcggttgacgaagttcaccgacctggcgctgcgagcggtgatgcgcctggcggtctcc
acgcaggacgtttccatgacgacgcgtgaggtggcggaggcgatggaggtgccctacgcc
cacatggccaaggccgtcacgcggctgcagcacctcggcgtggtggacgcgcggcggggt
cgcggcggcggactggaactgaccgagctcgggcggcaggcgtcggtcggctggctggtg
cgggagttggagggcgacgacgaggtggtggcctgcgagggcggcccgccgtgtccgttg
cgcgccgcctgccggctccgcggggccctgcgcacggcgcaggaagccttctacgccgcg
ctcgacccgctgaccgtgggcgagctggtcgcctccccgaccggtccggtcctgctcggc
ctcgtgggcggcccccgcaccccctga

DBGET integrated database retrieval system