KEGG   Streptomyces sp. MOE7: STRMOE7_05235Help
Entry
STRMOE7_05235     CDS       T05374                                 

Definition
(GenBank) cytochrome
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: ARH89798
UniProt: A0A1W5XIW3
LinkDB All DBs
Position
1143232..1144494
Genome map
AA seq 420 aa AA seqDB search
MSALPDPVELYGTEYTRDPYPLYAELRARGPVHRVRFPSGVCAWLVTGYRAAQQTLTDPR
LGKHHARGNAAWRARASIMPEPQRSRLQVHLLHQDPPRHTVLRRLITDAFAPQRVAALAP
RFQERAEALADALPERAADLVEAFAARFPFAVLAEVIGLPAEFADRFDRDWGKVVQPVGP
GEPGRPAYEARLRGLQRYIADLVVHKRREPAGDLLSRLVAACDGGDIGPAELDSMIFQLL
VAGQEPVTHQISTALVALLRHPERLAELAARPELLPRAVEELLRYDSAFELTTWRFFAED
ADLHGTRIPAGDSVIVSLCAANRDRERFPDADSLDLGRSPNPHLAFGHGIHFCPGAALAR
LELRIALETLLRRLPGLRLAVPDAGLRWIPAVLARGVDRLPVSYGAGGGCPVADGPVAAC
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcactgcccgatcccgtcgagctgtacgggacggagtacacccgcgatccctat
ccgctctacgccgagctgcgggcacgcggcccggtgcaccgggtgcgtttccccagcggg
gtgtgcgcctggctcgtcaccgggtaccgggccgcgcagcagacgctgaccgacccgcgg
ctgggcaagcaccatgcgcggggcaacgccgcctggcgggcccgggcctcgatcatgccg
gagccgcagcgctcccggctgcaggtgcatctgctccaccaggacccgccccggcacacc
gtgctgcgccggctgatcaccgacgccttcgcgccgcagcgggtggcggcgctcgcgccg
cgcttccaggagcgggccgaggcgctggccgacgcgcttccggagcgcgcggcggatctc
gtcgaggcgttcgccgcccgcttcccgttcgccgtgctcgccgaggtcatcggcctgccg
gcggagttcgcggaccgcttcgaccgggactggggcaaggtggtgcaaccggtggggccc
ggcgagcccggccgcccggcgtacgaggcgcggctgcgggggcttcagcggtacatcgcc
gacctggtcgtccacaagcgccgggagccggccggggatctgctctcccggctggtggcc
gcgtgcgacggcggggacatcgggccggcggagctggattcgatgatcttccagctgctg
gtcgcgggccaggagccggtcacccaccagatcagcaccgcgctggtcgccctgctgcgc
cacccggagcgcctcgccgaactggccgcccgccctgagctgctgccccgcgccgtggag
gaactgctgcggtacgacagtgccttcgagctgacgacctggcggttcttcgccgaggac
gccgatctgcacggcacccggataccggcgggtgactcggtgatcgtgtcgctgtgcgcg
gccaaccgcgaccgggagcgcttccccgacgcggactccctggacctcggccgctccccc
aatccgcatctcgcgttcgggcacggcatccacttctgccccggtgccgcgctcgcccgg
ctcgaactccggatcgcgctggagaccctgctgcggcggctgccgggcctccgcctggcc
gttcccgatgccgggctccggtggattccggcggtgctcgcgcggggcgtcgaccggctg
ccggtgtcctacggggccggcggcggctgccccgtggcggacgggccggtcgccgcgtgc
tga

DBGET integrated database retrieval system