KEGG   Streptomyces sp. MOE7: STRMOE7_05245Help
Entry
STRMOE7_05245     CDS       T05374                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC CHDCT2
Motif
Other DBs
NCBI-ProteinID: ARH89799
UniProt: A0A1W5XIV1
LinkDB All DBs
Position
1145624..1145983
Genome map
AA seq 119 aa AA seqDB search
MLRARDAMDRAYAQPLDVAALARIAHVSEAHFSRVFRATFGETPHRYLQRRRVERAMFLL
RETDRRVTDISFEVGFNSPGTFSRTFHDIVGRSPREYRKQAAATGVPTCFMMTWSRPST
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcacgggacgcgatggaccgtgcctatgcgcagccgctggacgtggcggcc
ctggcccggatcgcccatgtctcggaggcgcatttctcgcgcgtcttccgggcgacgttc
ggtgagacgccccaccgctacctgcagcgccgtcgggtcgagcgcgcgatgttcctgctg
cgggagaccgatcgccgggtgaccgacatcagcttcgaggtgggcttcaacagtcctggg
accttcagtcgcaccttccatgacatcgtcggccggtcgccgagggagtaccgcaagcaa
gcggcggccacgggcgtgcccacctgcttcatgatgacgtggtcgcgaccgagtacctga

DBGET integrated database retrieval system