KEGG   Streptomyces sp. MOE7: STRMOE7_05265Help
Entry
STRMOE7_05265     CDS       T05374                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
stro  Streptomyces sp. MOE7
Brite
KEGG Orthology (KO) [BR:stro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stro02000]
    STRMOE7_05265
Transporters [BR:stro02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    STRMOE7_05265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: ARH95096
UniProt: A0A1W5XZ24
LinkDB All DBs
Position
complement(1148442..1149479)
Genome map
AA seq 345 aa AA seqDB search
MVALAATACGGARDSGPGDGPGASGRGSGFPVRIADCQGRTTTFTAPPRKIVTSNAAALE
MLLRLGAGDRVIGTGFPPGKGALPGELGERARKVPVLGKHIIPKEKLLASGADLYIDTFA
SMGAMGGAGDAPTPEEFRAAGIKHLYLASTACAPTNGKPQRDLSAVEGDIRRLGAVTGTA
GRADALVAGMRAKLSTVREAVGGLAADERPTYFFFDYDAGTKQPMAVCRKQLANAVITLA
GARNVFDGCDGDFKAVSWEDVVAKDPDWIQLAVRNRGDAAADDAAYDRAAAFLKSFPATK
GLTAVRKGRFLRIGSERTTIAGVRNAETVEEIAHTLHPTRFKAAR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcgctggccgcgaccgcctgcggcggcgcacgcgacagcggccccggcgacggc
ccgggcgcctccgggcgcggctccggattcccggtgcggatcgccgactgccagggccgt
acgaccaccttcacggccccgccccgcaagatcgtcaccagcaacgccgccgccctggag
atgctgctccggctcggcgcgggcgaccgggtcatcggcaccggattcccgcccggcaag
ggagccctgcccggggaactgggcgagcgggcccgaaaggtgccggtgctgggcaagcac
atcatccccaaggagaaactgctcgcctcgggcgccgacctctacatcgacaccttcgcg
tcgatgggtgccatgggcggcgccggcgacgcgccgacccccgaggagttccgcgcggcc
gggatcaagcacctctatctggcgtccaccgcctgcgccccgacgaacgggaagccgcag
cgcgacctgtccgcggtggagggtgacatcaggcggctcggcgcggtgaccgggaccgcc
ggacgcgcggacgccctggtggcgggcatgcgcgcgaagctctccacggtgcgcgaggcg
gtcggcggcctcgcggccgacgagcggcccacgtacttcttcttcgactacgacgccggg
accaagcagccgatggccgtctgccgcaagcagctcgccaacgccgtgatcaccctggcc
ggggcgcgcaacgtcttcgacggctgcgacggggacttcaaggcggtctcctgggaggac
gtggtcgcgaaggatccggactggatccagctcgcggtacgcaaccggggcgacgccgcc
gccgacgacgccgcgtacgaccgggccgcggccttcctcaagagcttccccgccacgaag
gggctgacggccgtgcgcaagggccgcttcctgcggatcggctcggagcgtacgacgatc
gccggggtccgcaacgcggagaccgtcgaggagatcgcgcacacgctccacccgacgcgg
ttcaaggcggcccgctag

DBGET integrated database retrieval system