KEGG   Streptomyces sp. MOE7: STRMOE7_05400Help
Entry
STRMOE7_05400     CDS       T05374                                 

Definition
(GenBank) hypothetical protein
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_16 SKN1
Motif
Other DBs
NCBI-ProteinID: ARH89825
UniProt: A0A1W5XIZ9
LinkDB All DBs
Position
complement(1185737..1186456)
Genome map
AA seq 239 aa AA seqDB search
MPGHWREVFADDFGGTRLNPARWTTCYDWNQGGCTNRGNNELEWYRPEQVSVGDGKLTLT
ARRRTTRGTDGRRYPWTSGMVSTGRSSWNARPRFVFTYGYFEAAVRIPPQAGMLPAFWLM
PASRHTPPELDVAEGLGSTDRIEMTVHWKGPAGEERTAAGRFGPVDFPAGHHVFALNWER
DALTWYVDGEVRFRVTDPAKIPHVPMELLFTLAVGYPTVPPPGVDHARMSVDWVRVWQH
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgccggggcactggcgtgaggtcttcgcggacgacttcggcggcacccggctcaacccg
gcccgctggacgacctgttacgactggaaccagggcggctgcaccaaccgcggcaacaac
gagctggagtggtaccgcccggagcaggtgtcggtcggcgacggcaagctcacgctgacc
gcccggcgccggacgacccggggcacggacggccgccgctatccgtggacgtccgggatg
gtctccaccggccgcagctcgtggaacgcccggccgcgcttcgtcttcacctacggctac
ttcgaggcggccgtgcggatccccccgcaggccgggatgctgcccgccttctggctgatg
ccggcgtcccggcacacgcccccggaactcgatgtcgccgaggggctcggcagcaccgac
cggatcgagatgacggtgcactggaaggggccggccggcgaggaacgcaccgccgcgggg
cggttcgggccggtggacttccccgccggccaccacgtcttcgcgttgaactgggagcgg
gacgcgctcacctggtacgtggacggcgaggtccgcttccgggtcaccgatcccgcgaag
atcccgcacgtgccgatggagctgctgttcaccctcgcggtcggctacccgacggtgccg
ccgcccggggtggaccacgcccggatgtcggtggactgggtgcgggtctggcagcactga

DBGET integrated database retrieval system