KEGG   Streptomyces sp. MOE7: STRMOE7_07030Help
Entry
STRMOE7_07030     CDS       T05374                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ARH90092
UniProt: A0A1W5XJQ5
LinkDB All DBs
Position
1558002..1558994
Genome map
AA seq 330 aa AA seqDB search
MKAAVISAPGKVEVTTVEDPTPGPREVVVSVAACGLCGTDLHILQGEFAPTLPVVPGHEF
AGTVVATGSAVTELAEGDRVAVDPSLYCYECHYCRLGRNNLCERWAAIGVTTAGGAAEFA
VAPVANCVKLPDHVRTEDAALIEPLSCAVRGYDILRSQQLGSQVLIYGSGTMGLMMLELA
KRTGAAGVDVIDINPQRLATARTLGCSNAAGSADELDRPRGWDVVIDATGNERAIQDALG
RVGKGGTFLQFGVADYAARATIEPYRIYNQEITITGSMAVLHSYERAAELFAAGVLDPEV
FISDRLPLDRYAEALARFRAGEGRKIQVRP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcagtgatcagcgcccccggcaaggtcgaggtcaccaccgtcgaggacccc
acccccggcccccgcgaggtcgtggtctcggtcgccgcctgcgggctgtgcggcaccgat
ctgcacatcctccagggcgagttcgcgcccaccctgccggtcgtgccgggccacgagttc
gccgggaccgtcgtcgccaccggcagcgcggtcaccgaactcgccgagggcgaccgggtg
gccgtcgacccctccctctactgctacgagtgccactactgccgcctcggccgcaacaac
ctctgtgagcgctgggccgcgatcggcgtgaccacggccggcggcgccgccgagttcgcg
gtcgcccccgtcgccaactgcgtcaagctgcccgaccacgtacgcaccgaggacgcggcg
ctgatcgagccgctgtcctgcgccgtccgcggctacgacatcctgcgctcccagcagctg
ggcagccaggtcctcatctacggctccggcaccatgggcctgatgatgctggaactcgcc
aagcgcaccggcgcggccggcgtcgacgtcatcgacatcaaccctcagcggctggccacc
gcccgcacgctgggctgcagcaacgcggccggttcggccgacgagctggaccgcccgcgc
ggctgggacgtggtcatcgacgccaccggcaacgagcgcgccatccaggacgcgctcggc
cgggtcggcaagggcggcaccttcctccagttcggcgtggccgactacgcggcccgcgcc
accatcgagccgtaccgcatctacaaccaggagatcaccatcaccggttcgatggccgtc
ctgcacagctacgaacgcgccgccgagctgttcgcggcgggggtgctggacccggaggtc
ttcatcagcgaccggctcccgctggaccggtacgcggaggcgctggcgcggttccgggcc
ggggaggggcgcaagatccaggtacggccgtga

DBGET integrated database retrieval system