KEGG   Streptomyces sp. MOE7: STRMOE7_07095Help
Entry
STRMOE7_07095     CDS       T05374                                 

Definition
(GenBank) 4-hydroxybenzoate 3-monooxygenase
  KO
K00481  p-hydroxybenzoate 3-monooxygenase [EC:1.14.13.2]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00362  Benzoate degradation
stro01100  Metabolic pathways
stro01120  Microbial metabolism in diverse environments
stro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_07095
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.2  4-hydroxybenzoate 3-monooxygenase
     STRMOE7_07095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 NAD_binding_8 Pyr_redox_2 Pyr_redox_3 FAD_binding_2 Thi4 HI0933_like DAO Amino_oxidase IlvN Lycopene_cycl SE Trp_halogenase Glu_dehyd_C Pyr_redox NAD_binding_7 AlaDh_PNT_C PaRep2b
Motif
Other DBs
NCBI-ProteinID: ARH90103
UniProt: A0A1W5XJQ0
LinkDB All DBs
Position
complement(1571488..1572696)
Genome map
AA seq 402 aa AA seqDB search
MSSPAEPVLQRTSVVIIGAGPAGLTTANVLRAAGVDCVVLEAESREFVEQRPRAGFVEEW
AVRALARRGLADRLLESAETQGQFEFRFDGERHTVPTAQLSGRRHFVYPQPLLVTDLAAA
YVDRAAGDARFGVRDVRLHDIDGERPAVSYTDPGTGVRHRIESDFIAGCDGARGVSRAAI
PAGKTLLTRYDHGVAWLALLAEAPPSADGVVFGIHESGFGAHMARSPEVTRYYLQVAPGE
DAGNWPHTRVWDALHTRLAAAGAPPLTEGPLLEKVVLDMHNYVVEPMTYGRLHLAGDAAH
LVAPIAAKGMNLALNDALLLADALIAHYRGDDSGLAGYSQACLRRVWQYLEFSQWLSEVL
HGASSGDRFRAGTASARLRRLLGSDSAAKAFAGLYLGEEADL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctctcctgccgaacccgtcctccagcgcacctcggtcgtcatcatcggtgccgga
cccgccgggctcaccacggcgaatgtgctgcgcgccgccggtgtcgactgcgtggtgctg
gaggccgagagccgggagttcgtcgaacagcggccgcgcgcggggttcgtcgaggagtgg
gcggtgcgcgcgctggcccggcgcggcctggccgaccggctgctcgaaagcgccgagacc
caggggcagttcgagttccgcttcgacggtgagcggcacaccgtcccgacggcacagctg
tcgggacggcgtcatttcgtctatccgcagcccctgttggtcaccgacctggccgcggcg
tacgtggaccgggcggccggcgacgcccgcttcggcgtccgggacgtgcgactgcacgac
atcgacggggagcggcccgcggtctcgtacaccgaccccgggaccggcgtccggcaccgt
atcgagtccgacttcatcgcgggctgcgacggggcgcgcggggtgagccgggcggcgata
cccgccgggaagaccctgctcacccgctacgaccacggtgtcgcctggctggcgctgctc
gccgaggcgccgccgtccgcggacggggtggtcttcggtatccacgagagcgggttcggc
gcgcacatggcacgcagccccgaggtcacccgctactaccttcaggtcgcccccggggag
gacgccggcaactggccgcacacacgggtgtgggacgcgctgcacacccgactcgcggcg
gccggcgcaccgccgctgaccgaaggaccactgctcgaaaaggtggtcctggacatgcac
aactacgtggtggagccgatgacgtacggccggctccacctggccggcgacgcggcgcac
ctggtcgcgccgatcgccgccaagggcatgaacctcgctctcaacgacgcgctgctgctc
gccgacgcgctgatcgcgcactaccggggcgacgacagcggcctggccggctactcccag
gcgtgtctgcgccgggtctggcagtacctggagttctcgcagtggctgtccgaggtgctg
cacggcgcgtcctccggcgaccgcttccgggccggtacggcgtccgcccggctgcggcgg
ctgctgggctccgacagcgccgcgaaggcgttcgccggcctgtacctcggcgaggaagcc
gacctgtaa

DBGET integrated database retrieval system