KEGG   Streptomyces sp. MOE7: STRMOE7_07170
Entry
STRMOE7_07170     CDS       T05374                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00072  Synthesis and degradation of ketone bodies
stro00650  Butanoate metabolism
stro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STRMOE7_07170
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_07170
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     STRMOE7_07170
SSDB
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 KR THF_DHG_CYH_C 2-Hacid_dh_C ApbA Ldh_1_N NmrA GDP_Man_Dehyd RmlD_sub_bind 3HCDH_N
Other DBs
NCBI-ProteinID: ARH90116
UniProt: A0A1W5XJS8
LinkDB
Position
complement(1587172..1588029)
AA seq 285 aa
MTMIGAPGAPDSPGTPTTPAAAGAPGLPGPVALDLTGRTALVTGAAGGIGRACALRLAAA
GATVRAVDRDASGLTRLAADLPPGAPGTIEPRPLDLTDLDAAEQAAAGTDLLVNNAGIQL
VRPIEEFPPDVFHQVLTVMLEAPFRLLRGALPHMYAQGWGRVINISSVHGLRASPFKSAY
VAAKHGLEGLSKTAALEGAPHGVTSNCVNPGYVRTPLVERQIADQAAAHGIPEERVVTDI
LLADTAIKRLLEPEEVAEAVAYLCTPQASFMTGTSLVLDGGWTAH
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaccatgatcggtgccccaggggcccccgactccccaggaacgcccaccacgccggcc
gcagcgggtgccccgggtctccccgggccggtggccctcgacctcaccggccgcaccgcc
ctggtcaccggcgcggccggcggcatcggacgcgcctgtgccctgcggctcgcggcggcc
ggtgccaccgtccgcgcggtcgaccgggacgcgtccggcctcacccgcctcgccgccgac
ctgccgcccggcgcccccggcaccatcgaaccgcggcccctggacctcaccgacctcgac
gccgccgagcaggccgcggccggcaccgacctgctggtcaacaacgccggcatccagctc
gtccgccccatcgaggagtttccaccggacgtcttccaccaggtgctgaccgtcatgctg
gaggcgcccttccggctgctgcgcggcgccctgccccacatgtacgcgcagggctggggc
cgcgtcatcaacatctcttccgtgcacgggctgcgcgcctccccgttcaagtccgcgtac
gtcgcggccaagcacggtctggagggcctgtcgaagaccgcggcgctggaaggcgccccg
cacggcgtcaccagcaactgcgtcaaccccggatatgtccgcacgcccctggtggagcgg
cagatcgccgaccaggcggccgcgcacggcatccccgaggagcgcgtcgtgaccgacatc
ctgctggccgacaccgccatcaagcggctcctcgaaccggaggaggtggccgaggccgtc
gcctacttgtgcaccccgcaggcgtcgttcatgacgggcacctcgctggtgctcgacggg
ggctggaccgcgcactga

DBGET integrated database retrieval system