KEGG   Streptomyces sp. MOE7: STRMOE7_07610Help
Entry
STRMOE7_07610     CDS       T05374                                 

Definition
(GenBank) polyketide synthase
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Epimerase PKS_DE Thiolase_N Polysacc_synt_2 Docking GDP_Man_Dehyd 3Beta_HSD ACP_syn_III NAD_binding_4 NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ARH90188
UniProt: A0A1W5XK03
LinkDB All DBs
Position
complement(1693955..1704457)
Genome map
AA seq 3500 aa AA seqDB search
MSNMSKPDANAGSPATPNMTEEKLRDYLKRVVNDLRQTRRRLSEAEAKDHEPIAIVAMGC
RFPGDVRSPEELWRLVRDGGDAITAFPDNRGWDVETLYDPDPEKSGTTYVREGGFLHDAA
EFDPAFFGISPREALAMDPQQRLLLETSWEAFERAGIDPQSLRGSRTGVFVGSNYQDYAT
RLPEVPEEAEGHIGIGNTPSVVSGRVSYTFGLEGPAVTVDTACSSSLVALHLACHALRQG
DCTMALAGGISVMSSPASYIEFSRQRGLAPDARVKAFGAGADGTALSEGVGLFVVERLSD
AQRNGHPVLAVIRGSAINQDGASNGLTAPNGPSQERVIRQALAHARLTPDQVDVVEAHGT
GTTLGDPIEAQALLATYGQGRAEDRPLWLGSVKSNIGHTQAAAGAASLIKMIMAFDAATL
PRTLHADEPSHRIDWSAGAVELLTEEREWPSEAGRVRRAGISSFGISGTNAHLVLEEPPA
AEVEELPVVDAPGASASVVVPWVVSGRGEGALRAQAARLRSFVEARPELAPADIAYSLVT
SRAAVENRAVVLGTDRSGLLEGLSAVSRGEVPAAGVVQGAGAVREVGRTVLVFPGQGSQW
VGMGAELIASSPVFAEWMRRCGEALAPFVDWDLLEVVSEGRGLDRVDVVQPVTWAVMVSL
AELWRSVGVVPDAVVGHSQGEIAAAVVAGGLSLEDGARVVALRSQVIGRELAGRGGMASI
ALPEAEVRQRIDKTAELGIAAVNGLSSTVVSGDADAVEAFVVACEVDGVRARRIAVDYAS
HSAHVEAIEQELLTVLKDVRPQAGSVPFYSTVENAFLDTEVLDAAYWYRNLRHQVQFEAG
IRALAADGFTAFVESSAHPVLTVGIQETLDETDTEAVVTGSLRRDEGGLERFLTSAAELY
VTGVPVDWTPFLAGEGVRRVDLPTYAFQRERFWLEVPASTAPVATAPLAGGDVVDGRFWA
AVEAEDWESLSGTLALAGDAPLSAVVPALASWRRERQRASTVQNWRYRVTWKPAPDARRT
AAVDDTWLVVVPTGHAEDAAVTGAVEALTEGGAYVEQVELSATDADRVAWRARIEEWHAA
AQLGDRPLAGVLSLLALDERPHAGHGAMAAGVAGTLALVQALAEAGVEARLWLGTRGAVS
VGGTDQVLSAVQAQVWGLGRVVALELPERWGGLVDLPEAWDGRAGARLCAVLAGALDDED
QLAVRGSGVFARRLVRAPLAAAGRADEAGAQPGAGVSSDTGTDARTGTGTGTATDADAAW
RTRDTALVTGGTGALGPHIARWLADNGAEHVVLVSRRGAAAPGMTELRDELAARGVRLTA
SACDVADRDAVAALLAGLAADGDTVRTVIHAAAFIELAALTEADPAEFADVLAAKVAGAA
HLDALLDPDDLDAFVLFSSIAGVWGSGDHGAYAAANAFLDALAEQRHARGLPASSIAWGV
WDVWDPERLPEGVKPEQLQARGLPFLDPDTAFSALRQVLAHNEACVTVADVDWDRFVPVF
TSAGPRPLLDGVPEAQQALDAGGGSVGAGGGATGVPADASPSPLRDRLSGLAPAERHAVL
LDLVRAQAASVLGHASPEAVAPTRAFRDLGFDSLTAVELRNRLRTATGLRLPATLIFDYP
SPAVLAGFLRGEILGTEESAATAAPAAAVLPASDDDPIVIVGMACRFPGEVRSPEELWEL
LARGGEAISELPTDRGWDVESLYDPDPERPGKTYTRHGGFLHDAADFDAGFFGISPREAL
AMDPQQRLLLETSWEAFERAGIDPQTLRGSSTAVFAGVSYHDYGSRLQEAPEGVEGYLGT
GNTASIASGRVSYLLGLEGPAVTLDTGCSSSLVAMHLAAQSLRQGESTLALAGGASVMAV
PTSFTEFSRQRGLSVDGRCRAFSADADGMGMAEGAAMLLLERLSDARRNGHPVLAVVRGT
AMNQDGASNGLTAPNGPSQQRVIRQALANARLSPSEVDAVEAHGTGTRLGDPIEAQALLA
TYGQGRAEDRPLWLGSVKSNIGHTQAAAGAAGVIKMVKALEQGQLPRTLHAAEPTPQVDW
SAGAVELLTEERAWPSSPERVRRAGVSSFGISGTNAHLVLEEPPAPEAEELPVVAEPGAS
ASVVVPWVVSGRGVEALRAQAGRLRSFVGARPELEPVEVGRSLAVSRSAFERRAVALGAD
RGALLGALGAVSRGEVPAAGVVEGSVREVGRTVLVFPGQGSQWVGMGAELIASSPVFAES
MRRCAEALAPFVDWDLLEVVSEGRGLDRVDVVQPVTWAVMVSLAELWRSVGVVPDAVVGH
SQGEIAAAVVAGGLSLEDGARVVALRSQVIGRELAGRGGMASIALPEPEVRDRLTSQTGL
GLAAVNGPLSTVISGDAAAVEAFVVACEADGVRARRIAVDYASHSAHVEAIEQELLTVLE
SVRPQAGSVPFYSTVENAFLDTEVLDAAYWYRNLRHQVQFEAGIRALAAEGFTIFVESSA
HPVLTVGIQETLDETDTEAVVTGSLRRDEGGLERFLTSAAELYVTGVPVNWTPFLAGEGT
RPVDLPTYAFQRERFWLEASASAVGDMAAAGLTTASHPLLGAAVEVAGSDEVLFTGRLSL
ESHAWLADHAVAGTVLLPGTAFVELAVRAGDEVGCGQVEELALEAPLIVPERGGVALQLG
LGAADDSGRRALSIYSRAPGDERGPWTRHATGTLASAAAETADVPAGTDLAVWPPVGAEP
IAIEGYYDRLAAQGYGYGPAFHGLRAAWRRGDELFAEVQLPEAVAADAAAFGLHPALLDA
ALHTLGLGAVPDVGEGRARLPFSWSGVSLHRTGAAGLRVRVTPLDQDTVAVTVADPTGAP
VASIESLVTRPVSTESLRAASSPVRDAMFAVDWHQLPAAGSAAPVRRWAVLGSGEGADVT
DVAAVGQVAGLVSALERSGVTVSCHADLAALAAAQSQSPHDVPDVVVFPCLAGNREGTGL
AEATHAALRRVLGVVQAWLDDERFASSRLVVLTRGAVATTPDETELDLPHAAVWGLLRSA
QSEHPDRFVLVDVDTATDTGVDSATDTGVDSGTDTAVETDAVMGSVRVLGAVVACGEPQV
AVRGGVLWVPRVVRARVPVVGARDGVWGEGAVLVTGASGVLAGVVVRHLVSACGVRRVVL
VSRRAADQLAAEVRELGAEAVVVACDVADRGVLAGVFAAHRISAVVHAAGVLDDGVVGAL
SPERVAGVLRPKVDGAVVLDEVSRGVDLKAFVLFSSAAGTLGGPGQGSYAAANAFLDALA
QRRRALGLPATSLGWGFWEERSGLTGHLGRADLNRMSRVGIAPMTSLEGLALFDAACATD
EPMLLPMRLETSALRALAASGTVPPLLSALVRTPVRRTAADGGGAANGAESLQERLSKVS
AAERAGALEDLVVAQVASVLGHASVAAVEPGRPFKELGFDSLTAVELRNRLKNATGLRLP
ATLVFDHPTPEAVAAHLGAKLFPDAANTAPGAGAPGDPTPDEGSRAGTGGDRDGAQDLTD
SIDTMDIDHLVSLALDGKDG
NT seq 10503 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacatgtcgaagcccgacgcgaacgccggctcccccgccacccccaacatgacc
gaggaaaagctccgcgattacctcaagcgcgtcgtcaacgatctgcgccagacccgtcgc
cgactgagcgaggcggaggcgaaggaccacgagccgatcgccattgtggccatgggctgc
cgtttccccggcgacgtgcggtcgccggaagagctgtggcgcctggtgcgtgacggcggc
gacgccatcaccgcatttcccgacaaccgtggctgggacgtcgagacgctgtacgacccg
gacccggagaagtcgggcacgacgtatgtacgcgaaggcggtttcctgcacgacgcggcg
gaattcgacccggcgttcttcgggatttcgccgcgtgaggcgttggcgatggatccgcag
cagcggttgctgctggagacgtcgtgggaggcgttcgagcgggccggaatcgatccgcag
tcgctgcgcggttcgcgcacgggcgttttcgtcggctccaattaccaggactacgccacc
cgtctgcccgaggtgcccgaagaggcggaggggcacatcggcatcggcaatacgccgagt
gtggtctcgggccgggtgtcgtacacgttcgggctggagggtccggcagtgacggtggac
accgcgtgctcgtcgtcgctggtcgccctgcatctggcctgccatgcgctgcgccagggc
gactgcacgatggcgctggccggcggcatctccgtgatgtcctcgcccgcttcgtacatc
gagttcagccggcagcgggggctcgcgccggacgcccgggtcaaggcgttcggagcgggc
gcggacggcacggcgctgtccgagggggtgggcctgttcgtcgtggaacggctgtcggac
gcccagcgcaacggccacccggtgctcgccgtcattcgtggcagcgccatcaaccaggac
ggtgcgagcaacggcctgacggcccccaacggcccgtcccaggaacgcgtcattcgccag
gcactggcgcacgcccgcctgaccccggaccaggtggacgtggtggaggcgcacggcacc
ggtacgacgctgggcgatccgatcgaggcgcaggcgttgctggcgacgtacgggcagggc
cgggcggaggaccggccgttgtggctcggttcggtgaagtcgaacatcggccacacccag
gccgctgcgggtgccgcctccctcatcaagatgatcatggcgttcgatgcggcgaccctg
ccgcgcacgctgcatgccgacgagccctcacaccgcatcgactggtcggcgggcgcggtg
gagctgctgaccgaggagcgggagtggccttcggaagccggccgggtgcgtcgtgccggt
atctcgtcgttcgggatcagcggcaccaacgcccatctcgtactggaggagccaccggcc
gcggaggtcgaggagctgccggtggtggatgccccgggggcttccgcgtcggtcgtggtg
ccgtgggtggtctcggggcgtggtgagggggcgttgcgggcgcaggcggcgcggctgcgg
tcgttcgtcgaggcgaggccggagctggcaccggccgatatcgcgtactccctggtgacg
agccgggccgcggtggagaaccgtgcggtggtgctgggcaccgaccggtcgggcctgctg
gaggggctgagtgcggtgtctcgtggcgaggtgccggcggctggtgtggtgcagggggcg
ggtgcggtccgtgaggtgggccggactgttctggttttccctggtcagggttcgcagtgg
gttggtatgggcgcggagttgatcgcgtcgtcgccggtgttcgctgagtggatgcggcgg
tgtggtgaggcgctggctccgttcgttgactgggatctgctggaggtggtttccgagggc
cgtgggttggaccgggtggatgtggtgcagccggtgacgtgggcggtgatggtctcgctt
gcggagttgtggcggtcggtgggtgtggtgcccgatgcggtggtgggtcactcgcagggt
gagattgctgctgcggtggtggcgggtggtctgtcgctggaggacggtgctcgtgtggtg
gcgctgcggtcgcaggtcatcggccgcgagttggctgggcggggtggcatggcgtccatc
gcgctgcccgaggctgaggtgcgtcaacgcatagacaaaacagcagagttgggcattgcc
gcagttaatggtttgtcctcgacggtggtgtccggggacgccgatgcggttgaggcgttc
gtggtggcctgtgaggttgatggggttcgggcgcgtcgtattgcggtggattacgcgtcg
cattcggcgcatgtggaggccatcgagcaggagctgctgaccgtcctgaaggacgtacgg
ccgcaggcgggcagtgtcccgttctactcgacggtggagaacgccttcctcgacaccgag
gtcctggacgccgcgtactggtaccggaatctgcggcatcaggtgcagttcgaggcgggt
attcgggcgctggccgcggacggtttcaccgcgttcgtggagtccagtgcgcatccggtg
ctgaccgtcggtattcaggagacgctcgacgagacggacaccgaggccgtcgtcacagga
tcactgcgccgtgacgagggtggtctggagcgtttcctgacctcggccgccgagctgtac
gtcaccggtgtgccggtggactggacgccgttccttgcaggtgagggcgtccgtcgcgtc
gatctgccgacgtatgccttccagcgtgaacgcttctggctggaggtcccggcgtcgacg
gccccggtggcgacggccccccttgccgggggcgacgtggtggatggccgtttctgggcg
gcggtggaggcggaggactgggagtcgctgagcgggaccctggcactggccggtgatgcg
ccgctgagcgcggtggtccccgcgttggcgtcctggcgccgcgagcggcagcgggcgtcg
accgtgcagaactggcgctaccgcgtgacctggaagccggcgcccgacgcccggcgcacg
gcagccgtggacgacacctggctggtggtggtcccgaccgggcatgccgaggacgcggcg
gtgaccggtgccgtcgaggcgctgaccgaaggcggcgcgtacgtcgagcaggtggagctg
agtgccaccgatgcggaccgtgtggcctggcgcgcccgtatcgaggagtggcacgccgcc
gcgcagctcggtgaccggcccctcgccggggtgctgtcgctgctcgcgctggacgagcgt
ccgcatgccggccacggggcgatggccgccggcgtggcggggacgttggcgctggtgcag
gcactggcggaagcgggcgtcgaggcccgactgtggctggggacccggggcgcggtgtcc
gtcgggggcacggaccaggtgctgagcgcggttcaggcgcaggtgtggggcctgggccgc
gtggtcgccctggagctgccggagcgctggggcggtctggtggacctgcccgaggcgtgg
gacggcagggccggcgcgcggttgtgcgcggtgctggccggggcgctggacgacgaggac
cagctcgcggtgcggggctcaggggtcttcgcccgtcgtctcgtccgggctccgctcgcg
gcagcgggccgggcggacgaggccggtgcgcagcccggggcgggagtgagcagcgatacg
ggtaccgatgcccgtacgggtacgggtaccggcacggcgacggacgccgacgccgcctgg
cggacccgcgatacggctctggtcaccggcggcaccggggccctcggcccgcacatcgct
cgctggctcgcggacaacggtgccgagcacgtggtgctcgtcagccggcgcggcgccgcc
gcaccgggcatgaccgagctgcgggacgaactcgccgccaggggagtccggttgaccgcg
tccgcctgtgatgtcgcggaccgcgacgcggtcgccgcgctcctggccgggctcgcggcg
gacggcgacaccgtacgtacggtcatccacgccgccgccttcatcgagctggccgcgctg
accgaagccgacccggccgagttcgccgacgtgctcgccgcgaaggtcgccggcgcggcc
cacctggacgccctgctcgacccggacgacctggacgccttcgtcctcttctcctccatc
gccggcgtctggggcagcggcgaccacggcgcgtacgccgcggccaatgccttcctggac
gccctcgccgaacagcgccacgcacggggcctgccggccagctccatcgcgtggggcgtg
tgggacgtatgggatcccgagcggctgccggagggcgtcaagccggagcaactccaggcc
cgcgggctgccgttcctcgacccggacaccgccttctccgccctgcgtcaggtcctcgcg
cacaacgaggcgtgcgtcaccgtcgccgatgtggactgggaccgcttcgttccggtcttc
acctcggcgggaccgcgtccgctgctcgacggcgtgcccgaagcacaacaggcgctcgac
gcgggcggcggttccgtgggcgcgggcggtggcgccaccggcgtaccggccgacgcctcc
ccgtcgccgctgcgcgaccgcctgtccggactggcgccggccgaacgccacgccgtactg
ctcgatctggtccgggcccaggccgcgtcggtcctcggccatgcctcgcccgaggccgtc
gcacccacccgggccttccgggacctgggcttcgactcgctcaccgccgtcgagctgcgc
aaccgtctcaggaccgccaccggtctgcgcctgccggccacgctgatcttcgactacccg
tcccccgccgtcctcgccggctttctgcgcggtgagatcctcggtacggaggagtccgcg
gccacggccgccccggcagcggccgtactcccggcgtccgacgacgacccgatcgtcatc
gtgggaatggcatgccgcttccccggcgaggtccggtccccggaggagctgtgggagctg
ctggcgcgcggcggcgaggcgatctcggagctgccgaccgatcgtggctgggacgtcgag
tcgctctacgaccccgacccggaacgaccgggcaagacgtacacccgtcacggcggcttc
ctgcacgacgcggcggattttgatgcggggttcttcgggatttcgccgcgtgaggcgttg
gcgatggatccgcagcagcgtttgctgctggagacgtcgtgggaggcgttcgagcgggcc
ggcatcgacccgcagacgctgcgcggcagcagcaccgcggtcttcgccggggtcagctac
cacgattacggctcgcgtctccaggaggcgcccgagggcgtcgagggctacttgggcacg
ggcaacacggcgagcatcgcctcgggccgggtctcctacctcctgggcctggagggtccc
gccgtcacgctggacaccggttgctcgtcgtcgctggtcgccatgcatctggccgcgcag
tcgctgcgccagggagagtccacgctggcgctcgccggcggcgcgtccgtcatggccgta
cccacctccttcacggagttcagccgacagcgcgggctgtccgtcgacggccggtgccgg
gcgttctcggcggacgcggacggcatgggcatggccgaaggagccgccatgctgctgctg
gagcggctgtcggacgcgcggcgcaacggccacccggtcctggccgtggtacgcggcacc
gcgatgaaccaggacggtgcgagcaacggtctcaccgcgccgaacggtccctcgcagcag
cgcgtgatccgacaagcgctggccaacgctcgtctgtcgccgtccgaggtggatgcggtg
gaggcgcacggtacggggacccggctgggtgatccgatcgaggcgcaggcgttgctggcg
acgtacgggcagggccgggcggaggaccggccgttgtggctcggttcggtgaagtcgaac
atcggccacacccaggccgcggccggcgcggccggggtcatcaagatggtcaaggccctg
gaacaagggcagttgccccgcaccctgcacgccgccgagccgacgccccaggtggactgg
tcggcgggtgcggtggagctgctgacggaggagcgggcctggccgtcgtccccggagcgg
gtgcggcgtgccggtgtctcgtcgttcgggatcagtggcaccaacgcccatctcgtactg
gaggagccaccggccccggaggccgaggagctgccggtcgtggctgaaccgggggcttcc
gcgtccgtcgtggtgccgtgggtggtctcgggtcgtggtgtggaggcgttgcgggcgcag
gcgggacggttgcgatcgttcgtcggcgccaggccggagctggaaccggttgaggtgggg
cgttcgttggcggtgtcgcggtcggccttcgagcggcgtgcggtggcgctgggtgctgac
cggggtgcgttgttgggggcgctgggtgcggtgtctcgtggtgaggtgccggcggctggt
gtggtggaggggtcggtccgtgaggtgggccggaccgttctggttttccctggtcagggg
tcgcagtgggttggtatgggcgcggagttgatcgcgtcgtcgccggtgttcgctgagtcg
atgcggcggtgcgcggaggcgctggctcccttcgttgactgggatttgctggaggtggtg
tctgagggccgtgggttggaccgggtggatgtggtgcagccggtgacgtgggcggtgatg
gtctcgcttgcggagttgtggcggtcggtgggtgtggtgcccgatgcggtggtgggtcac
tcgcagggtgagattgctgctgcggtggtggcgggtggtctgtcgctggaggacggtgct
cgtgtggtggcgctgcggtcgcaggtcatcggccgcgagttggccgggcgtggcggcatg
gcgtccatcgctttgcctgaacccgaggtacgggaccgcctgacgtcgcagacgggtctc
ggtctcgctgccgtcaacggccccctgtccaccgtcatttcgggcgatgcggctgccgtc
gaggcgttcgtggtggcctgtgaggccgatggggttcgggcgcgtcgtatcgcggtggat
tacgcgtcgcattcggcgcatgtggaggccatcgagcaggagctgctgaccgtcctggag
agcgtacggccgcaggcgggcagcgtcccgttctactcgacggtggagaacgccttcctc
gacaccgaggtgctggacgccgcgtactggtaccggaatctgcggcatcaggtgcagttc
gaggccggtattcgggcgctggcggcggagggtttcaccatcttcgtggagtccagtgcg
catccggtgctgaccgtcggcattcaggagacgctcgacgagacggacaccgaggccgtc
gtcacaggatcactgcgccgtgacgagggtgggctggagcgtttcctgacctcggccgcc
gagctgtacgtcaccggtgtgccggtgaactggacgccgttcctcgcaggtgaaggcacc
cggcccgtcgatctgccgacgtatgccttccagcgtgaacgcttctggctggaagcctcc
gcttcggctgtcggtgacatggcggctgccgggctgacgaccgcgagccatccgttgttg
ggggcggcggttgaggttgccgggtcggatgaggtgttgttcacggggcggttgtcgctg
gagtcgcatgcgtggctggcggatcatgcggtggccgggacggtgttgttgccgggtacg
gcgtttgtggaactcgcggtgcgtgccggtgacgaggtcggttgcgggcaggtcgaggag
ctggcgttggaggctccgctgatcgtgccggagcgtggcggtgtcgccctccagctcgga
ctgggcgccgccgatgactccggacgccgggccttgagcatctattcgcgtgcgccgggc
gacgagcgcggtccctggacgcggcacgccaccggcacgctggcctccgccgccgcagaa
accgcggacgtcccggccgggacggacctcgcggtgtggcccccggtgggcgcggaaccg
atcgcgatcgagggctactacgaccggctcgccgcgcagggatacggatacggtccggcc
ttccacgggctgcgggcggcctggcggcgcggcgacgagctgttcgccgaggtccagctg
cccgaggcggtggcggcggacgcggcggccttcggcctgcaccccgccctgctggacgcc
gccctgcacacgctgggcctcggagcggtgcccgacgtgggggagggacgggcacgtctg
ccgttctcctggagcggggtgtcgctccaccggacgggcgccgccgggctacgcgtacgg
gtcacgccgctggaccaggacaccgtcgcggtgacggtcgccgaccccacgggcgcaccg
gtggcgtcgatcgagtcgctggtcacccggccggtctccaccgagtcgctcagggccgcg
agttcgcccgtgcgcgacgcgatgttcgcggtggactggcaccagctcccggcggccggc
agcgcagctcccgtccgtcgttgggccgtgctgggcagtggcgagggggcggacgtcaca
gacgtggcggccgtgggacaggtcgccggtctggtcagcgcgctggagcgttccggcgtg
accgtgtcctgccacgccgacctggccgctctcgctgccgcccagtcacagtcgccgcac
gacgttcccgacgtcgtggtcttcccgtgcctcgcggggaaccgcgagggcaccgggctc
gccgaggccacccatgccgcgctgcgccgggttctcggagtggtgcaggcatggctggac
gatgagcgtttcgcctcgtcgcggctggtcgtcctcacccgaggtgcggtcgcgaccaca
cccgacgaaacggagctggaccttcctcatgccgccgtgtggggtttgttgcggtcggcg
cagtcggagcatccggatcggttcgtgctggtggacgtggatacagccacggacacgggc
gtggactcggccacggacacgggcgtggactcgggcacggacacggccgtggagacggac
gcggttatgggttccgtgcgggtgttgggtgcggtggtggcgtgtggggagccgcaggtt
gcggtgcgtgggggtgtgctgtgggtgcctcgcgttgttcgggcgcgggtgccggtggtg
ggtgcgcgggatggtgtgtggggcgagggtgcggtgctggtgacgggtgccagtggtgtg
ctggcgggtgtggtggtgcggcatctggtgagcgcctgtggggtgcgtcgtgtggtgttg
gtgtcgcggcgtgctgctgatcaattggctgctgaggtgcgtgagttgggtgccgaggcg
gtggtggtggcgtgtgatgtggcggatcgtggtgtgttggcgggggtgtttgctgcgcat
cggatttcggctgtggtgcatgcggcgggtgtgttggatgacggtgtggtgggggcgttg
tcgccggagcgggtggcgggtgtgctgcggccgaaggtggacggggcggtggtgttggat
gaggtgtcgcggggtgtggatctgaaggcgtttgtgctgttttcttctgcggcggggacg
ttgggtggtccggggcaggggagttatgcggcagcgaatgcgttcctggacgcgctggcg
cagcgacgtcgagcactcggcctgcccgccacctccctcggctggggcttctgggaggag
cgcagcgggctgaccggccacctcggccgtgccgacctgaaccgcatgtcgcgggtgggc
atcgctccgatgacctcgctggaagggctggccctgttcgacgcggcctgcgcgacggac
gaaccgatgctgctgccgatgcggctggagacctccgcgctgcgtgcgctggccgcgtcc
ggcaccgtgccgccgctgctcagcgcgctggtacggactccggtccgccgtaccgcggcg
gacggcgggggcgcggcgaacggcgcggagtcgttgcaggagcggctcagcaaggtctca
gcggcggagcgggccggtgccctggaagatctggtcgtcgcgcaggtggcgtccgtactg
gggcacgcttccgtcgcggcggtcgagcccggccgtccgttcaaggagctgggcttcgac
tcgctgaccgcggtcgagctgcgcaaccgtctcaagaacgccaccgggctgcgcctgccg
gccaccctcgtgttcgaccatccgacgcccgaggccgtcgccgcccacctgggggccaag
ctcttccccgacgcggcgaacaccgcaccgggtgccggcgcaccgggtgatcccacgccg
gacgaaggctcccgcgcgggcaccggcggggaccgggacggggcccaggacctcacggac
tcgatcgacacgatggacatcgatcacctcgtcagcctcgccctcgacggcaaggacggc
tga

DBGET integrated database retrieval system