KEGG   Streptomyces sp. MOE7: STRMOE7_14475
Entry
STRMOE7_14475     CDS       T05374                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00072  Synthesis and degradation of ketone bodies
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00650  Butanoate metabolism
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STRMOE7_14475
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_14475
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_14475
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    STRMOE7_14475
Enzymes [BR:stro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     STRMOE7_14475
SSDB
Motif
Pfam: HMGL-like DUF5755
Other DBs
NCBI-ProteinID: ARH91308
UniProt: A0A1W5XN66
LinkDB
Position
3282393..3283334
AA seq 313 aa
MTTAGLPMQVPAEGLPTRVRIHEVGARDGLQNEQTVVPTEVKAEFVHRLADAGLPLVEAT
SFVHPKWVPQLADAEELFPRLGDLDPHRLPVLVPNDRGLDRALALGARRIAVFGSATESF
AKANLNRTVDEALAMFAPVVRRAKDARVHVRGYLSMCFGDPWEGPVPVAQTVRVCRALLD
LGCDELSLGDTIGVATPGHVQHLLAALNEAGVPTSKLGVHFHDTYGQALANTYAALQHGV
TTVDASAGGLGGCPYAKSATGNLATEDLVWMLHGLGIETGVDLDRLIATSVWMADVLGRP
SPSRTLRALSHKE
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaccacggcaggactcccgatgcaggtcccggcggaggggctgcccacccgcgtacgc
atccatgaggtcggcgcgcgcgacgggctgcagaacgagcagaccgtcgtgccgaccgag
gtcaaggccgagttcgtgcaccggctcgccgacgcgggcctgccgctggtcgaggcgacc
agcttcgtgcaccccaagtgggtgccgcagctcgccgacgcggaggagctgttcccgcgg
ctgggcgacctcgacccgcaccggctgccggtgctggtgcccaacgaccggggcctggac
cgtgcgctcgccctgggcgcccgccggatcgcggtgttcggcagcgccaccgagtccttc
gccaaggccaacctcaaccgcacggtcgacgaggcgctggcgatgttcgcacccgtggtg
cggcgcgccaaggacgcccgggtgcacgtccgcggctacctctcgatgtgcttcggcgac
ccgtgggagggtccggtgcccgtggcgcagaccgtccgggtctgccgggcgctgctggac
ctgggctgcgacgaactgagcctgggcgacaccatcggcgtggccacccccggccacgtc
cagcacctgctcgcggccctcaacgaggccggcgtgcccacctcgaagctcggcgtccac
ttccacgacacctacgggcaggccctcgccaacacctacgccgcgctccagcacggcgtg
accaccgtcgacgcctcggcgggcggcctcggcggctgcccgtacgccaagagcgccacc
ggcaacctcgccaccgaagacctcgtgtggatgctgcacggcctcggcatcgagaccggt
gtcgacctggaccggctgatcgccacgagcgtgtggatggccgacgtcctgggccggccg
agcccctcgcgcaccctccgagccctctcccacaaggagtga

DBGET integrated database retrieval system