KEGG   Streptomyces sp. MOE7: STRMOE7_15425Help
Entry
STRMOE7_15425     CDS       T05374                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Pex14_N
Motif
Other DBs
NCBI-ProteinID: ARH91458
UniProt: A0A1W5XNL3
LinkDB All DBs
Position
complement(3485912..3487546)
Genome map
AA seq 544 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVAGEPGETVAIKVLKEELAHDADV
VMRFLRERSVLLRLTHPNIVRTRDLVVEGDLLALVMDLVDGPDLHRYLRDNGPFSPVAAA
LLTAQIADALAASHADGVVHRDLKPANVLLAGSDGDGEMHPMLTDFGIARLADSPGLTRT
HEFVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGSTALEVLHRHLSEEP
RRPSTLPEPLWTVIERCLRKRPEERPSAENLARALRTVAAGVGVHATPAAAEAALGVAAL
LAPDPAPATVPGTGVGGAQGAGGDADPTQVLPSGPGAGGYDPAAATSVLPSTGGPGGRDA
DPTRAMPPMPMGAPSAGPQEPEGPHPWESQMRAARDRNDQTQVQYLDPGQDPLRRRPQRR
PAQQQPYPQQAPYGQPAPAPYAQQPQAPQRRPEPPPQRYEPQRPPAPEPRPRREPRPRSA
NPMRIPGLGCLKGCLVTLILLFVAAWLIWELTPLQEWIGTTRGFFSQIGHVYHQVERFVN
KLSA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccggtaggcagcaagtacctgctcgaggagccgctgggacgcggcgccacgggc
accgtctggcgtgcccgccagcgggagacggcaggggccgaggccgccgtggccggggag
cccggtgagacggtcgcgatcaaggtcctcaaggaggagctggcgcacgacgcggacgtg
gtgatgcgcttcctgcgggagcgctccgtcctgctgcggctcacccaccccaacatcgtg
cgcacccgggacctggtcgtcgagggtgatctgctcgcgctggtcatggacctggtcgac
ggcccggacctgcaccgctatctccgggacaacggcccgttcagcccggtggccgcggcc
ctgctgaccgcccagatcgccgacgcgctggccgcgagccacgccgacggggtggtgcac
cgcgacctcaagcccgccaacgtgctgctcgccgggtcggacggcgacggcgagatgcac
ccgatgctgaccgacttcggcatcgcgcggctcgccgactccccgggcctgacccgtacc
cacgagttcgtgggcactcccgcctatgtggcgccggagtccgccgagggccggccgcag
acctccgcggtggacatctacggcgccggcatcctgctgtacgagctggtcaccggccgt
ccgccgttcgccgggtcgacggccctggaggtgctgcaccggcatctgagcgaggagccg
cgccggcccagcacgcttcccgagccgctgtggacggtgatcgagcgctgtctgcgcaag
cgtcccgaggagcggccgagtgccgagaacctcgcgcgggcgctgcgcacggtcgcggcg
ggcgtcggggtgcacgccacgccggccgcggcggaggcggcgctcggcgtcgccgcgctg
ctcgccccggacccggcgccggcgaccgtccccggtacgggcgtcgggggcgcccagggg
gccggcggcgacgcggatccgacccaggtgctgccgtccgggcccggtgccggcggctac
gacccggcggcggcgacgagtgtgctgccgtccacgggcggccccggcgggcgggacgcc
gacccgacccgcgcgatgccgccgatgccgatgggcgcgccgtcggccggcccgcaggag
ccggaggggccccatccgtgggagtcccagatgcgggccgcgcgggaccgcaacgaccag
acccaggtgcagtacctggaccccggtcaggacccgctgcggcgccgtccgcagcgccgt
ccggcccagcagcagccgtatccgcagcaggccccgtacgggcagcccgctccggcgccg
tacgcgcagcagccgcaggccccgcagcgccgtccggagccgccgccgcagcgttacgag
ccgcagcggccgcccgccccggagccgcgtccccggcgtgagccgcgtccgcgcagcgcc
aacccgatgcggatcccgggcctgggctgcctcaagggctgtctggtgacgctgatactg
ctgttcgtggcggcctggctgatctgggagctgaccccgctgcaggagtggatcggtacg
acccgcggcttcttctcgcagatcggacacgtgtaccaccaggtggaacgcttcgtgaac
aagctcagcgcctga

DBGET integrated database retrieval system