KEGG   Streptomyces sp. MOE7: STRMOE7_18775Help
Entry
STRMOE7_18775     CDS       T05374                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00380  Tryptophan metabolism
stro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    STRMOE7_18775
Enzymes [BR:stro01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     STRMOE7_18775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ARH92004
UniProt: A0A1W5XQ83
LinkDB All DBs
Position
complement(4247939..4249255)
Genome map
AA seq 438 aa AA seqDB search
MSETPYTPGIPGTADAAGPVGERPLAGRARELDAADPLAALRDRFVLDTVVDPATGLPDV
YLDGNSLGVLPRTVPDRIADVLHREWGELRIRSWTESGWWTAPERVGDKIAPLIGAGPGR
VVVGDSTSVNIFKAVVGGVRMAGKGCTEILVDATTFPTDGYIARSAARMTGLAVRPVEPA
RIADEVTERTALALVNHVDYRTGALNDLPGITHALHSAGALAVWDLCHSAGALPVGLDAH
HVDLAVGCTYKYLNGGPGSPAFLYVRESLQERFESPLPGWNSHAEPFAMDPSYTPADGVR
RGRVGTPDILSLLALEAALEVWDGVAIEDVRAKSLALTDFFLECVAGYVPAGRARAVTPQ
DHQRRGSQVSLRCAGAGEVMDELIRRGVVGDFRRPDVLRFGFTPLYTSFADAERAARVLG
EVLGALPEVGPAAAGTGG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaccccgtacaccccgggcatccccgggaccgccgacgccgccgggcccgtc
ggggagcgtccgctcgcgggccgtgcccgggagctggacgccgccgatccgctcgccgcg
ctccgggaccgcttcgtcctcgacaccgtggtcgacccggcgaccggtctgccggacgtc
tacctcgacggcaactccctgggcgtgctgccccgcacggtgcccgaccggatcgccgac
gtcctccaccgcgagtggggcgagctgcgcatccgctcgtggaccgaatccggctggtgg
accgcgccggagcgggtcggcgacaagatcgcgccgctgatcggcgcgggcccgggccgg
gtggtggtcggcgactcgaccagcgtgaacatcttcaaggccgtggtcggcggcgtccgg
atggccgggaagggctgcacggagatcctggtcgacgccacgaccttcccgaccgacggc
tacatcgcccggtcggcggcccggatgaccgggctcgcggtgcggcccgtggagcccgcg
cggatagccgacgaggtcaccgagcgcaccgcgctggcgctggtcaaccacgtcgactac
cgcaccggcgcgctcaacgacctgcccggcatcacccacgccctgcactccgcgggggcg
ctcgccgtctgggacctgtgccacagcgcgggcgcgctgccggtcggcctggacgcccac
cacgtcgacctggccgtcggctgcacgtacaagtacctcaacggcgggcctggctcgccc
gccttcctgtacgtccgcgagagcctccaggagcggttcgagtcgccgctgcccggctgg
aactcgcacgccgagccgttcgcgatggatccctcctacacccccgcggacggcgtccgg
cgcggccgcgtcggtacccccgacatcctgtcgctgctcgcgctggaggccgcgctggag
gtctgggacggggtcgccatcgaggacgtccgggccaagagcctggccctgacggacttc
ttcctggagtgcgtggccgggtacgtaccggccggccgggcgcgggcggtcacgccgcag
gaccaccagcggcgcggcagccaggtgtcgctgcgctgcgccggggcgggcgaggtgatg
gacgagctgatccggcgcggggtggtcggcgacttccgccggcccgacgtgctgcggttc
ggcttcaccccgctctacacgtccttcgcggacgcggagcgggcggcccgggtgctcggc
gaggtgctgggggcgctgcccgaggtgggaccggccgcggccgggaccggcgggtga

DBGET integrated database retrieval system