KEGG   Streptomyces sp. MOE7: STRMOE7_21895Help
Entry
STRMOE7_21895     CDS       T05374                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00250  Alanine, aspartate and glutamate metabolism
stro00410  beta-Alanine metabolism
stro00430  Taurine and hypotaurine metabolism
stro00650  Butanoate metabolism
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro02024  Quorum sensing
Module
stro_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STRMOE7_21895
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STRMOE7_21895
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_21895
   00430 Taurine and hypotaurine metabolism
    STRMOE7_21895
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    STRMOE7_21895
Enzymes [BR:stro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     STRMOE7_21895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ARH92503
UniProt: A0A1W5XRJ9
LinkDB All DBs
Position
complement(4935370..4936776)
Genome map
AA seq 468 aa AA seqDB search
MTLHKGAPPAERKHTRHPVNPFYGEADPVSGMETSPPRHTLPDGPLAPHAAYQFVHDELM
LDGNARLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWHAP
GAVGCSTTGSSEACMLAGMALKRRWMRRNADRYPASARPNLVMGANVQVCWEKFCNFWEI
EARQVPMQGDRFHLDADSAAALCDENTIGVVAVLGSTFDGSYEPVADICAALDDLHEKKG
WDIPVHVDGASGAMIAPFLDPELKWDFQLPRVASINTSGHKYGLVYPGVGWALWRDEEAL
PEELVFRVNYLGGDMPTFALNFSRPGAQVAAQYYTFLRLGRAGYRAVQQATRDVARSMAE
RIGALGDFELLTRGDELPVFAFTTAGHITAYDVFDVSRRLKERGWLIPAYTFPPDREDLS
VLRIVCRNGFSLDLADLFLSDLEELLKELREQRGPLGRPENEATAFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcacaaaggcgcgcccccggccgagcgcaagcacacccggcacccggtcaac
cccttctacggtgaggccgacccggtctccggcatggagacctcgccgccccggcacacc
ctgcccgacggcccgctcgccccgcacgccgcctaccagttcgtccacgacgaactcatg
ctggacggcaacgcccgcctcaacctggcgaccttcgtcacgacctggatggagccgcag
gccggcgtcctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccg
cgcaccgccgaactggagcggcgctgcgtggcgatgctcgccgacctgtggcacgccccc
ggcgcggtcggctgttccaccaccgggtcgagcgaggcgtgcatgctcgccggcatggcc
ctcaaacggcgctggatgcggcgcaacgccgaccggtacccggcctccgcgcggcccaac
ctcgtcatgggcgccaacgtccaggtctgctgggagaagttctgcaacttctgggagatc
gaggcgcgccaggtcccgatgcagggcgaccgcttccacctcgacgccgactccgccgcc
gcactgtgcgacgagaacaccatcggcgtggtggccgtcctcggctccaccttcgacggg
tcctacgagccggtggccgacatctgcgcggcgctcgacgacctccacgagaagaagggc
tgggacatcccggtccacgtggacggcgcgtccggcgcgatgatcgccccgttcctcgac
ccggagctgaagtgggacttccagctgccgcgggtcgcctccatcaacacctccggccac
aagtacggcctggtctaccccggcgtcggctgggccctgtggcgcgacgaggaggcactc
cccgaggaactcgtcttccgcgtcaactacctcggcggcgacatgccgaccttcgccctc
aacttctcccgccccggcgcccaggtggccgcccagtactacaccttcctgcggctcggc
cgggccggttaccgcgccgtccagcaggccacccgggacgtcgcccgctccatggccgaa
cgcatcggcgccctgggcgacttcgagctcctcacccgcggcgacgaacttccggtcttc
gccttcaccaccgccggccacatcaccgcctacgacgtcttcgacgtgtcccggcgcctg
aaggaacgcggctggctgatccccgcctacaccttcccgcccgaccgcgaggacctctcc
gtcctgcgcatcgtctgccgcaacggcttctccctggacctcgccgacctcttcctctcc
gacctggaagagctcctcaaggaactacgggaacagcggggccccctgggccgcccggag
aacgaggcgaccgccttccaccactga

DBGET integrated database retrieval system