KEGG   Streptomyces sp. MOE7: STRMOE7_29885Help
Entry
STRMOE7_29885     CDS       T05374                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
stro  Streptomyces sp. MOE7
Brite
KEGG Orthology (KO) [BR:stro00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    STRMOE7_29885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ARH93807
UniProt: A0A1W5XVE1
LinkDB All DBs
Position
6804918..6805907
Genome map
AA seq 329 aa AA seqDB search
MQPANEPTERAGRLTRARVLYRNVSTRRLAWLLLKDIVHSCMTYRVTGLAAEAAFWCLLS
LPPLILGLLGVLGYTQAWIGHDTLAGVRQHILGVAGTVLSDKGVNEIARPLLNDVFTGRR
PDVISIGFALALWSGSRALNVFVDTITIMYGLDGRRGIVKTRLLAFALYLGGLLVGAVAL
PLMVAGPDTVVGWLPASEHVIRALYWPIVLLVSIAFLTTLYHLSVPVRSPWPEDIPGAVV
ALGIWVLGSFLLRLYLTSTVEGPTIYGSLAAPVAVLLWIGVSAFAVLVGAAMNAALDRVW
PSAATAEAREEMARRAAAKRGADADGQDD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgcagccggcaaacgaaccaaccgagcgggcgggccgtctgaccagggcccgcgtcctg
taccgcaatgtctccacacgccggctggcctggctcctgctcaaggacatcgtgcactcc
tgcatgacgtaccgggtcaccgggctggccgcggaggccgccttctggtgtctgctgtcg
ctgccgccgctgatcctcgggctcctcggcgtcctcggctacacgcaggcgtggatcggg
cacgacaccctcgccggcgtccgtcagcacatcctcggcgtcgccggcaccgtgctctcc
gacaagggcgtgaacgagatcgcccgcccgctgctgaacgacgtcttcaccggccgtcgc
cccgacgtcatctcgatcggcttcgccctcgcgctgtggtccggttcgcgcgcgctgaac
gtcttcgtcgacaccatcacgatcatgtacgggctcgacggccggcgcggcatcgtcaag
acacggctgctggccttcgcgctctacctcggcgggctgctggtcggcgccgtcgcgctg
ccgctgatggtggccggccccgacacggtggtgggctggctgccggccagcgaacacgtc
atccgggcgctgtactggccgatcgtcctgctggtgtcgatcgccttcctcaccaccctc
taccacctgtccgtgcccgtgcgttcgccctggccggaggacatccccggcgcggtggtc
gcgctcggcatctgggtgctcggcagtttcctgctgcggctctacctcacctcgacggtc
gaggggcccacgatctacgggtcgctggccgccccggtggcggtgctgctgtggatcggg
gtgtccgccttcgcggtcctggtgggcgccgcgatgaacgcggcgctggaccgggtgtgg
ccgtcggccgccacggccgaggcgcgcgaggagatggcgcgccgggcggcggcgaagcgg
ggcgccgacgccgacgggcaagacgactga

DBGET integrated database retrieval system