KEGG   Streptomyces sp. MOE7: STRMOE7_30890Help
Entry
STRMOE7_30890     CDS       T05374                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:stro00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    STRMOE7_30890
Enzymes [BR:stro01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     STRMOE7_30890
DNA repair and recombination proteins [BR:stro03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     STRMOE7_30890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ARH93966
UniProt: A0A1W5XVT4
LinkDB All DBs
Position
complement(7036498..7037469)
Genome map
AA seq 323 aa AA seqDB search
MAPTAEHGSAPYPVIRPMLATIGPLPDEHEEAEWAFEAKWDGARCIVNTPGDGTIRLVTR
AGNDATMTYPELAPLGEQLRGRSAVLDGEVVVLDARGRPDFGLLQRRMGVVNPRRTARLA
MEHPVHLVLFDLMHLGGSLLGLPYHERRSLLSGLRLRGPNWSAPAYVAGHAQQAWDASLQ
GGLEGVVAKRLGSAYLPGVRSPDWRKTKHLQTLDVIIGGWTEGHGSLAGLPGSVLAGVAE
PAGLRYVGSVGSGLSDRERHGLAQYLGVIPRDRSPFVNPVDASGVHWAEPRLVAEITLTG
WTAAGRLRHPVWHRLRPDLTRLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaccgccgagcacggctcggccccgtaccccgtgatccggccgatgctggcc
acgatcgggccgctgcccgacgagcacgaggaggcggagtgggcgttcgaggccaagtgg
gacggcgcccgctgcatcgtcaacacccctggtgacggcacgatccggctggtcacccgg
gcgggcaacgacgcgaccatgacgtatccggagctggctcccctcggtgagcagttgcgc
gggcggtccgcggtgctggacggcgaggtggtggtgctggacgcgcgcgggcggccggac
ttcgggctgctgcagcggcggatgggcgtggtgaacccgcgccgtacggcccggctggcg
atggagcacccggtgcatctggtgctcttcgacctcatgcacctgggcggttcgctgctc
ggcttgccgtaccacgagcgccgttccctgctgtcggggctgcggctgcggggccccaac
tggtcggcgcccgcctacgtcgcggggcatgcgcagcaggcgtgggacgcctcgctgcag
ggcgggctggaaggggtcgtggccaagcggctgggctcggcgtatctgcccggcgtccgc
tcacccgactggcgcaagacgaagcatctgcagaccctcgacgtgatcatcggaggctgg
acggaggggcacggcagcctcgccggactgcccggttcggtgctggccggcgtcgcggag
ccggccgggctgcggtacgtcggttcggtcggctcgggactgtccgaccgggaacgccac
gggctcgcccagtatctgggggtgatcccgcgcgaccgctccccgttcgtcaaccccgtg
gacgcgtcgggcgtgcactgggccgagccccggctggtcgccgagatcacgctcaccggc
tggaccgcggcggggcggctgcggcatccggtctggcaccggctccggcccgatctgacg
cggctcggctga

DBGET integrated database retrieval system