KEGG   Streptomyces sp. MOE7: STRMOE7_30935Help
Entry
STRMOE7_30935     CDS       T05374                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00250  Alanine, aspartate and glutamate metabolism
stro00410  beta-Alanine metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro01100  Metabolic pathways
stro01120  Microbial metabolism in diverse environments
Module
stro_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_30935
   00650 Butanoate metabolism
    STRMOE7_30935
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STRMOE7_30935
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_30935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stro01007]
    STRMOE7_30935
Enzymes [BR:stro01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     STRMOE7_30935
Amino acid related enzymes [BR:stro01007]
 Aminotransferase (transaminase)
  Class III
   STRMOE7_30935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ARH93973
UniProt: A0A1W5XVU5
LinkDB All DBs
Position
7046800..7048122
Genome map
AA seq 440 aa AA seqDB search
MTHVPHEPATLHARHQAVLPSWLSLYYERPLELTHGEGRHVWDAEGNRYLDFFGGILTTM
TAHALPEVTKAVSEQAGRILHTSTLYLSRPMVELAERIAALSGIPDARVFFTTSGTEAND
TALLLATTHRRSNQILAMRNSYHGRSFSTVGITGNQSWSPTSLSPLQTLYVHGGVRSRGP
YAELSDRDFIAACVADLEDMLQQTAGGVAALIAEPVQGVGGFTAPPDGLYAAFREVLARH
GILWISDEVQTGWGRTGDHFWGWQAHADNGPPDLLTFAKGIGNGMSVGGVVARAEVMNSL
TANSISTFGGSPVTMAAGLANLNHLLEHDLQGNARRVGGLLIERMRAVTAGLGLVREVRG
RGLMIGLELVRPGTDEPSPEAASLVLEAARERGLLIGKGGQGGASLRIAPPMSLTVAEAE
EGAGLLAEALRTAQGTLAGT
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacgtcccccatgaaccggcgaccctgcacgcccgccaccaggccgtactgccc
tcctggctcagcctctactacgagcggccgctcgaactcacccacggcgagggccggcac
gtctgggacgccgagggcaaccgctacctcgacttcttcggcggcatcctcaccaccatg
acggcccacgcgctgcccgaggtgaccaaggccgtcagcgaacaggccggccgcatcctg
cacacctcgacgctctatctctcccgccccatggtcgagttggccgagcggatcgcggcg
ctctccggcatccccgacgcccgggtcttcttcaccacctccggcaccgaggccaacgac
acggccctgctgctggccaccacgcaccgccgctccaaccagatcctggcgatgcgcaac
agctaccacggccgctccttctccaccgtcggcatcaccggcaaccagagctggtcgccg
accagcctctcgcccctccagacgctctacgtccacggcggggtgcgcagccgcggcccg
tacgcggagctgagcgaccgggacttcatcgcggcctgcgtcgccgacctggaggacatg
ctccagcagaccgccggcggggtcgccgcgctgatcgccgaaccggtccagggcgtcggc
ggcttcaccgcaccgcccgacggcctctacgccgccttccgcgaggtgctcgcccggcac
ggcatcctgtggatcagcgacgaggtgcagaccggctggggccgtaccggcgaccacttc
tggggctggcaggcgcacgccgacaacggcccgcccgacctgctcaccttcgccaagggc
atcggcaacggcatgtccgtcggcggggtggtggcccgcgccgaggtgatgaactcgctc
accgcgaactccatctccaccttcggcggcagcccggtcaccatggccgccggcctggcc
aacctcaaccacctgctcgaacacgacctccagggcaacgcccggcgggtcggcgggctg
ctcatcgagcggatgcgggcggtcacggccggcctcggcctggtgcgcgaagtccgcggc
cggggcctgatgatcggcctcgaactggtccgccccggcaccgacgagccctcaccggag
gccgcctcgctcgtcctggaagcggcccgggagcgcggcctgctgatcggcaagggcggg
cagggcggcgcctcgctgcgcatcgcgcccccgatgtcgctgaccgtcgcggaggccgag
gagggcgccggcctgctcgccgaggcgctccgtacggcgcagggcacgctggccgggacg
tag

DBGET integrated database retrieval system