KEGG   Streptomyces sp. MOE7: STRMOE7_32145Help
Entry
STRMOE7_32145     CDS       T05374                                 

Definition
(GenBank) NADP-dependent succinic semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00250  Alanine, aspartate and glutamate metabolism
stro00310  Lysine degradation
stro00350  Tyrosine metabolism
stro00650  Butanoate metabolism
stro00760  Nicotinate and nicotinamide metabolism
stro01100  Metabolic pathways
stro01120  Microbial metabolism in diverse environments
Module
stro_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STRMOE7_32145
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STRMOE7_32145
   00310 Lysine degradation
    STRMOE7_32145
   00350 Tyrosine metabolism
    STRMOE7_32145
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STRMOE7_32145
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     STRMOE7_32145
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     STRMOE7_32145
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     STRMOE7_32145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh BCA_ABC_TP_C
Motif
Other DBs
NCBI-ProteinID: ARH95674
UniProt: A0A1W5Y0S1
LinkDB All DBs
Position
7320473..7321870
Genome map
AA seq 465 aa AA seqDB search
MAIATVNPATGETLKTFDALNAGEIEDHLVRAEQAFQEHRVTSFARRKELMLKAADLLEA
DQDGIARLMTTEMGKPVTQARAEAAKCVKTMRWYADRAETLLADEYPDSADVRDAGAVRA
VVRYRPMGTVLAVMPWNFPLWQVVRFAAPALMAGNTGLLKHASNVPQTALYLEELFRRAG
FPEGCFQTLLIGSGAVEDILRDPRVVAATLTGSEPAGRAVASVAGDEIKKTVLELGGSDP
FLVLPSADLDKAARVAVTARAQNNGQSCIAAKRFIVHSDVYDAFTERFTAGMAALKVGDP
MEETTDVGPLSSEQGRSDLEELVDDAVHQGATALCGGRRPPQHRAGWFYEPTVLAGITPG
MRIHHEEAFGPVATLYRVADVDEAVRIANDTPFGLSSNAWTRDPDEKVRLARDLEAGGVF
FNGMTASHPGLPFGGAKRSGYGRELSGHGIREFCNMTTLWYGPED
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccacggtcaacccggccaccggcgagaccctcaagaccttcgacgcgctc
aacgcgggcgagatcgaagaccacctggtcagggcggagcaggcattccaggaacaccgg
gtgacgtccttcgcccggcgcaaggagctgatgctcaaggccgccgacctgctggaggcg
gaccaggacggcatcgcccgcctgatgaccaccgagatgggcaaaccggtgacccaggcc
cgcgcggaggccgccaagtgtgtcaagaccatgcgctggtacgccgaccgggccgagacg
ctgctcgccgacgagtaccccgactcggccgacgtccgtgacgcgggtgccgtgcgcgcc
gtggtccgctaccggcccatgggcaccgtcctcgcggtgatgccgtggaacttcccgctc
tggcaggtcgtacggttcgccgcgccggcgctgatggcgggcaacaccggactgctcaag
cacgcctcgaacgtcccgcagaccgcgctctacctggaggagctgttccgccgggccggc
ttccccgagggctgcttccagaccctgctgatcggctccggtgccgtcgaggacatcctg
cgcgacccgcgggtggtcgccgcgacgctcaccggcagcgagcccgccggccgcgcggtg
gcctcggtcgccggagacgagatcaagaagaccgtcctcgaactgggcggcagcgacccg
ttcctcgtgctgccctccgcagacctcgacaaggcggcccgggtggccgtcaccgcacgc
gcccagaacaacggccagtcctgcatcgcggccaagcggttcatcgtgcacagcgacgtc
tacgacgccttcaccgagcggttcaccgcgggcatggccgccctgaaggtcggcgacccg
atggaggagaccaccgacgtggggccgctctccagcgagcagggccgctccgacctggag
gagctggtcgacgacgcggtccaccagggcgcgaccgcgctgtgcggcgggcggcggccg
ccccagcaccgcgccggctggttctacgagccgacggtcctcgccggcatcacccccggc
atgcgcatccaccacgaggaggcgttcggcccggtcgccacgctctaccgcgttgccgac
gtcgacgaggcggtgcggatcgccaacgacaccccgttcggcctcagttccaacgcctgg
acccgcgacccggacgaaaaggtgcggctggcacgggacctggaggccggcggcgtcttc
ttcaacggcatgaccgcctcccaccccgggctccccttcggcggggccaaacgctccggc
tacgggcgggagttgtcggggcacggcatccgcgagttctgcaacatgacgaccctctgg
tacggcccggaggactga

DBGET integrated database retrieval system