KEGG   Streptomyces sp. MOE7: STRMOE7_32465Help
Entry
STRMOE7_32465     CDS       T05374                                 

Definition
(GenBank) acetoacetate decarboxylase
  KO
K01574  acetoacetate decarboxylase [EC:4.1.1.4]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00072  Synthesis and degradation of ketone bodies
stro00640  Propanoate metabolism
stro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_32465
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    STRMOE7_32465
Enzymes [BR:stro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.4  acetoacetate decarboxylase
     STRMOE7_32465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADC
Motif
Other DBs
NCBI-ProteinID: ARH94224
UniProt: A0A1W5XWH5
LinkDB All DBs
Position
7398863..7399600
Genome map
AA seq 245 aa AA seqDB search
MQQHDVVRRHATPLTNPAYPPVNPRFTNREYLNIVYRTDRDALRAVVPEPLEIEEPLVRF
EVMRMGDVTGYGPYTEAGQAIPVRHDGERGEYLHAMYLDNFPATASGREASAYPKTVGAP
ALYVDHGALVGVLDHGTVRVATATMGYKHHELDPEAAAAQLTVPTFMLKLEPGFDGAPRT
AQLVRTRISDVVVKGAWTGPARLQLFHHVLAPLADLPVREIVSASHLVTDLTLAPVRPVH
DYLVR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcacgacgtcgtccggcggcacgccacacccctgaccaacccggcgtatccg
ccggtcaacccgcgcttcaccaaccgggagtacctcaacatcgtctaccgcaccgaccgg
gacgcgctgcgcgccgtggtgcccgagccgctggagatcgaggaacccctggtccgcttc
gaggtgatgcggatgggcgacgtcaccggatacgggccgtacaccgaggccgggcaggcc
ataccggtccggcacgacggcgagcgcggcgagtacctgcacgccatgtacctggacaac
ttccccgccaccgcgtccggccgggaggcgagcgcctaccccaagaccgtcggcgcgccc
gccctctacgtcgaccacggcgcgctggtcggcgtgctcgaccacggcacggtgcgggtg
gccaccgcgacgatgggctacaagcaccacgagctggaccccgaagcggcggccgcgcag
ctcaccgtgccgaccttcatgctcaagctggagcccggcttcgacggcgcgccgcggacc
gcgcagctggtccgcacccggatcagcgacgtggtggtcaagggcgcctggaccgggccc
gcccggctccagctgttccaccacgtccttgccccgctggccgatctgccggtgcgcgag
atcgtctccgccagccacctcgtcaccgacctcaccctcgcgcccgtccggccggtgcac
gactacctcgtgcgctga

DBGET integrated database retrieval system