KEGG   Streptomyces sp. MOE7: STRMOE7_34260Help
Entry
STRMOE7_34260     CDS       T05374                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:stro00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    STRMOE7_34260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:stro03400]
    STRMOE7_34260
Enzymes [BR:stro01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     STRMOE7_34260
DNA repair and recombination proteins [BR:stro03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     STRMOE7_34260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ARH94526
UniProt: A0A1W5XXE7
LinkDB All DBs
Position
7836456..7837340
Genome map
AA seq 294 aa AA seqDB search
MSPITVVEGRRLPLTNLDKVLYPETGTTKGEVVHYCTTTAEPLLAHLHDRPLSFLRYPDG
PDGQRFFTKNVPPGTPSWVKTCEVPHSTSGPTRQALLQDLPSLVWAANLVVELHTPQWTC
RAPGTADRLVLDLDPGEPATVVECCTAAQWLHERLAADGLEVFAKTSGSKGLHLVVPIEP
TPSERATAYARTLAVEAARALPELVVHKMTKALRPGKVFIDFSQNAAAKTTAVAYTLRAR
ATPTVSAPVTWDEIADCRDPEQLSFLFGEIGPRIEHYGDLHAPLLDPDRARPLP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgatcaccgttgtggaggggcggcgcctcccgctgaccaacctcgacaaggtc
ctgtatcccgagaccggcaccaccaagggtgaggtcgtccactactgcaccaccaccgca
gagccgctgctcgcgcacctccacgaccggccgctgtccttcctgcgctaccccgacggg
cccgacggccagcgcttcttcaccaagaacgtgccacccggcacgccctcctgggtgaag
acctgcgaggtcccccattcgacgtccgggcccacccggcaggccctgctgcaggacctg
ccctcactcgtctgggccgcgaacctcgtcgtcgaactgcacaccccgcagtggacctgc
cgtgcgccgggcaccgccgaccgcctcgtcctcgatctggaccccggcgagcccgccacc
gtcgtcgagtgctgcaccgcggcgcagtggctgcacgagcggctggccgcggacggcctg
gaggtcttcgccaagaccagcggctccaagggcctgcatctggtcgtgccgatcgagccc
accccgtcggagcgggccaccgcctacgccaggaccctcgccgtcgaggcggccagggcc
ctgccggagctcgtcgtgcacaagatgaccaaggcgctgcggcccggcaaggtcttcatc
gacttctcccagaacgccgccgccaagaccaccgccgtcgcctacaccctgcgcgcccgc
gccacccccaccgtctccgccccggtcacctgggacgagatcgccgactgccgcgacccg
gagcaactcagcttcctcttcggcgagatcggtccccgcatcgagcactacggcgatctg
cacgcaccgctcctcgaccccgatcgggcccgaccgctgccctga

DBGET integrated database retrieval system