KEGG   Streptomyces sp. MOE7: STRMOE7_35265Help
Entry
STRMOE7_35265     CDS       T05374                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
stro  Streptomyces sp. MOE7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ARH94693
UniProt: A0A1W5XXW4
LinkDB All DBs
Position
complement(8040355..8041422)
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVSPMLAKLVTEIPAGMQYEAKWDGFRVIVFRDGDEVEITSRTTKPLTRYFPE
VVAAAREQLPARCVVDGEIVIAHDGRLHFEELLERIHPADSRVRTLAERTPASLVAFDLL
ALDTRALTAEPQSARREALVEALRPARPPVYTAPATTDQELARRWFTQFEGAGLDGVVAK
PLHLPYRPGDRALYKIKHARTADCVVAGYRLHKSGPVVGSLLLGLHDAEGQLQHVGVCAS
FPMARRRALVEELEPLRLDDVTEHPWGAWTDEAAHASRRMPGGPSRWSGGKDLSWVPLRP
ERVCEVAYDHMEGDRFRHTAQFRHWRPDRTPESCTYDQLEEPVGYDLGELLHDDR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcctgtcatgcccccggtctccccgatgctcgcgaagctggtgacggagatc
cccgccggcatgcagtacgaggccaaatgggacggcttccgggtgatcgtcttccgggac
ggcgacgaggtcgagatcaccagccggaccacgaaaccgctcacccggtacttccccgag
gtggtcgccgcggcgcgggaacagctgccggcgcgctgtgtcgtcgacggggagatcgtc
atcgcccatgacggacggctgcacttcgaggagctgctggagcgcatccaccccgcggac
tcccgggtccgtaccctcgccgaacgcacccccgcctccctcgtggccttcgacctgctg
gccctggacacccgggcgctgaccgccgaaccgcagtcggcgcgccgggaggcgctggtc
gaggcgttgcggccggcccggccgccggtgtacacggcgcccgcgacgacggaccaggag
ctggcgcgccgctggttcacccagttcgagggggcggggctggacggggtggtggccaag
ccgctccatctgccgtaccggcccggcgaccgcgccctgtacaagatcaagcatgcccgc
accgcggactgtgtcgtcgccggctaccggctgcacaagagcgggccggtggtcggctcg
ctgctgctgggcctgcacgacgccgaggggcagctccagcacgtcggggtgtgcgcctcg
tttccgatggccaggcgccgcgcgctcgtcgaggagctggagccgctgcggctggacgac
gtcacggagcacccgtggggggcgtggacggacgaggcggcgcacgcgtcgcggcggatg
ccgggcgggcccagccggtggagcggcggcaaggacctgtcgtgggtgccgctgcgcccg
gagcgggtgtgcgaggtcgcctacgaccacatggagggcgaccggttccggcacaccgcg
cagttccgccactggcggcccgaccgtacgccggagagctgcacctacgaccagctggag
gagccggtgggctacgacctgggggaactgctgcacgacgaccggtga

DBGET integrated database retrieval system