KEGG   Streptomyces sp. PAMC 26508: F750_2275Help
Entry
F750_2275         CDS       T02619                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00010  Glycolysis / Gluconeogenesis
strp00052  Galactose metabolism
strp01100  Metabolic pathways
strp01110  Biosynthesis of secondary metabolites
strp01120  Microbial metabolism in diverse environments
strp01130  Biosynthesis of antibiotics
Module
strp_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F750_2275
   00052 Galactose metabolism
    F750_2275
Enzymes [BR:strp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     F750_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: AGJ54769
UniProt: M9TWB7
LinkDB All DBs
Position
2348434..2349600
Genome map
AA seq 388 aa AA seqDB search
MTFSTGTSRRTVLAATAAAGLAVAAGAPAAHASATGRAPSKELFGTLADGTEVHRWTLAN
GGTRLKVLSWGGVVQSLEVPDRRGRTANVSLGFGGLPDYVAKSPYFGGLIGRYGNRIAGG
RFTLDGVTHQLPVNDGPNSLHGGDQGFDKRVWDVRPFTGRGDVGLVLTRTSPDGEAGYPG
SLAVRVVYTLTSRGEWRVDYTATTDRATVLNLTSHTYFNLAGEGSGSADGHLLELAAARY
TPVDATLIPTGELAPVARTPFDFRRSRALGEAVRTPHEQIGYGQGIDHNYVLDKGTTARP
EYALTVSDPGSGRVMKMYTTEPGMQVYTGNFLDGTLTGTSGRVYRQGDAFCLESQHFPDS
PNQPSFPSTVLRPGNTYRSTTVHAFSAR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcagcaccggaaccagcagacgtacggtcctggcggccacggccgccgccggg
ctggccgtggcggcgggagcccccgcggcacatgcctcggccaccggacgcgccccgtcc
aaggagctcttcggcactctcgccgacgggacggaggtgcaccgctggaccctcgccaac
ggcgggacccggctgaaggtcctctcctggggcggtgtcgtccagtccctggaggtcccc
gaccgccggggccggacggcgaacgtgtcgctcggcttcggcggcttgccggactacgtg
gcgaagtccccgtacttcggcgggctgatcgggcggtacggcaaccggatcgccgggggc
cgtttcaccctcgacggtgtcacgcaccaactgcccgtgaacgacgggcccaacagcctg
cacggtggcgaccagggcttcgacaagcgggtctgggacgtacggccgttcaccggacgc
ggtgacgtcgggctggtcctgacccggaccagcccggacggcgaggccggctatcccggc
tcgctcgccgtccgtgtcgtctacaccctcacctcccggggcgagtggcgcgtcgactac
acggcgaccacggaccgcgccacggtcctcaacctcaccagccacacctatttcaacctg
gcgggcgagggcagcggcagcgccgacgggcacctgctggagctcgcggcggcacgctac
acaccggtggacgcgacgctgatccccacgggcgagctcgccccggtggcgcgtacgccg
ttcgacttccggcggtcccgggccctcggggaggccgtccgcaccccgcacgagcagatc
gggtacgggcaggggatcgaccacaactacgtgctcgacaaggggaccacggcccgcccc
gagtacgcgctgaccgtctcggaccccggctcgggccgggtgatgaagatgtacacgacg
gaacccggcatgcaggtctacacggggaacttcctcgacggcaccctgaccggcacctcg
gggcgcgtctaccgccagggcgacgcgttctgcctggagtcgcagcacttccccgactcc
cccaaccagccgtcgttcccgtcgacggtgctccggcccgggaacacctaccgctcgacg
acggtgcacgccttctcggcacgctga

DBGET integrated database retrieval system