KEGG   Streptomyces sp. PAMC 26508: F750_2702Help
Entry
F750_2702         CDS       T02619                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:strp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    F750_2702 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:strp03400]
    F750_2702 (ligD)
Enzymes [BR:strp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     F750_2702 (ligD)
DNA repair and recombination proteins [BR:strp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     F750_2702 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AGJ55183
UniProt: M9TPN1
LinkDB All DBs
Position
2828283..2829257
Genome map
AA seq 324 aa AA seqDB search
MATLPLIAPMLATPGRLPPAAVDEQWAYEVKQDGQRAMAYLPGDGSIRLLARSGAVITPA
YPDLVALGPALGGVPAVLDGEIVALDEQGRSDFERLQSRMGLSGSPAKAARAAQRVPAHL
VLFDVVFLGDRSLVRLPWTERRAALEGLGLDGPHWSTPAVVVGHGEQALTMTREAGLEGL
VAKRLGSVYEPGVRARTWIKIRHARTADVIVGGWVPGRGRLGGLPGALLVGERHPGGLRY
AGSVGTGWSDAERARLAELLRVAAVDDCPFDDTPPVAGARWVLPRLVGEVRYATRTKAGR
LRQPSWHRLRPDLAPDDLEPDGLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccaccctgcccctgatcgcccccatgctcgccaccccgggccggctgccgcccgcc
gccgtcgacgagcagtgggcgtacgaggtgaagcaggacggccagcgcgccatggcctat
ctgccgggggacggttcgatccggctgctggccaggtcaggggccgtcatcaccccggcg
tatccggatctggtggctctgggacccgcgctcgggggcgtaccggcggttctcgacggt
gagatcgtcgcgctggacgagcaggggcgcagcgacttcgagcggctgcagtcgcggatg
ggactctccggatcacccgcgaaggccgcccgcgcggcgcagcgggtaccggcgcacctg
gtgctgttcgacgtcgtgttcctgggcgacaggagcctcgtacggctgccgtggacggag
cgcagggccgcgctcgaagggctcgggctggacgggccgcactggtcgacgcccgccgtg
gtcgtggggcacggcgagcaggccctgaccatgacgcgggaggccgggctggaggggctg
gtcgcgaagcggctgggctcggtgtacgaaccgggcgtccgcgcgcgtacctggatcaag
atccgccacgctcgcacggcggacgtgatcgtcggcggctgggtgccgggccggggccgg
ctgggcggcctgccgggggcgctgctggtcggcgaacggcacccgggcggcctgcgctac
gcgggcagcgtgggcaccgggtggagcgacgcggagagggccaggctcgccgaactgctc
cgggtcgccgccgtcgacgactgtccgttcgacgacacacccccggtggccggcgcccgg
tgggtgctgccccggctcgtcggcgaggtgcggtacgcgacccggacgaaggcggggcgg
ctgcgccagccgtcctggcaccggctgcggccggacctcgcgccggacgacctcgaaccg
gacggcctcgggtga

DBGET integrated database retrieval system