KEGG   Streptomyces sp. PAMC 26508: F750_3260Help
Entry
F750_3260         CDS       T02619                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00790  Folate biosynthesis
strp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    F750_3260
Enzymes [BR:strp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     F750_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AGJ55729
LinkDB All DBs
Position
3430345..3431178
Genome map
AA seq 277 aa AA seqDB search
MRGLPEWDRCAVMGVVNVTPDSFSDGGHWFDTTSAIKHGLELVAEGADLIDVGGESTRPG
ASRVDEAEELRRVIPVVRGLASEGVTVSVDTMRAVVAEQSVAAGAALVNDVSGGLADPGM
IPAVADAGVPFVVMHWRGFSESMNSRAVYGDVVGEVVAELRERMEAVIEGGVAPERLVID
PGLGFAKDAAQDLALVAHLDRLRDLGRPLLVAASRKRFLGHVLAAEGAAPPPARERDAAT
AAVSALSAAAGAWAVRVHAVRPTADAVRVARAVEGAA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgcggggtctgccggagtgggaccgctgcgcggtcatgggagtcgtcaatgtgacgccc
gactccttctccgacggcggtcactggttcgacaccacgtcagcgatcaagcacggcctc
gaactggtggccgaaggtgcggatctgatcgacgtcggcggtgagtcgacccgcccgggc
gcgagcagggtggacgaggccgaggaactgcgacgcgtgatccccgtcgtccgggggctg
gcctccgagggcgtcaccgtctccgtggacaccatgcgcgccgtcgtcgccgaacagtcc
gtggccgccggcgcggcgctggtcaacgacgtgagcggcggcctcgccgatccgggcatg
atcccggccgtcgccgacgccggagtgccgttcgtcgtcatgcactggcgcggtttcagc
gagtcgatgaacagccgggcggtctacggggacgtcgtcggggaggtcgtcgccgagctc
cgcgagcgcatggaggccgtgatcgagggcggggtcgcgcccgagcggctggtgatcgat
ccggggctcggcttcgccaaggacgccgcccaggacctcgcgctcgtcgcccacctcgac
cggctccgcgacctgggcaggcccctgctcgtcgccgcctcccgcaagaggttcctcggc
catgtcctggcggccgagggcgcggccccgcccccggcccgtgagcgggacgccgcgacg
gccgcggtctccgccctctccgccgccgcgggcgcctgggcggtccgggtgcacgcggta
cggccgacggcggacgcggtccgggtcgcccgcgccgtcgagggtgccgcgtga

DBGET integrated database retrieval system